mRNA_M-pyrifera_M_contig94468.21807.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig94468.21807.1 vs. uniprot
Match: A0A024TF71_9STRA (Fibronectin type-III domain-containing protein n=3 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TF71_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 1.970e-16 Identity = 54/135 (40.00%), Postives = 72/135 (53.33%), Query Frame = 1 Query: 76 WESHVSPRKFDVRAELVASIPLTGMRPNRGKAENAARFRRRIVLFERGGNVPLSHKVRQAMEEGALAVVIFDNTGRCDNDK-----FNQACVPGSDISNDDGFAALDPIAAWKGLDRIPTLLISRASGESLLAKL 465 W H SP+ + V AE+VA+ P+ RP EN R R + R G +PL +KV A GALAVVI D G CD+D F+ C GS+ + +GF A D A W + RIP +L+ R +LLA+L Sbjct: 750 WPGHFSPKTYSVVAEIVAASPVLADRP----LENDVRDR---IALVRRGKLPLFNKVLHAQNAGALAVVIVDADGLCDDDSGTGGTFDHHCSVGSNHAFGEGFGAQDDAAVWSAI-RIPHVLLLRGDAAALLARL 876 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig94468.21807.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig94468.21807.1 >prot_M-pyrifera_M_contig94468.21807.1 ID=prot_M-pyrifera_M_contig94468.21807.1|Name=mRNA_M-pyrifera_M_contig94468.21807.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=156bp PVAVVSDTLRRVSLLSESATVRVAGWESHVSPRKFDVRAELVASIPLTGMback to top mRNA from alignment at M-pyrifera_M_contig94468:96..563- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig94468.21807.1 ID=mRNA_M-pyrifera_M_contig94468.21807.1|Name=mRNA_M-pyrifera_M_contig94468.21807.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=468bp|location=Sequence derived from alignment at M-pyrifera_M_contig94468:96..563- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig94468:96..563- >mRNA_M-pyrifera_M_contig94468.21807.1 ID=mRNA_M-pyrifera_M_contig94468.21807.1|Name=mRNA_M-pyrifera_M_contig94468.21807.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=936bp|location=Sequence derived from alignment at M-pyrifera_M_contig94468:96..563- (Macrocystis pyrifera P11B4 male)back to top |