mRNA_M-pyrifera_M_contig93397.21564.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93397.21564.1 vs. uniprot
Match: A0A7S4T194_9DINO (Hypothetical protein n=1 Tax=Alexandrium monilatum TaxID=311494 RepID=A0A7S4T194_9DINO) HSP 1 Score: 56.6 bits (135), Expect = 1.030e-6 Identity = 32/72 (44.44%), Postives = 43/72 (59.72%), Query Frame = 1 Query: 175 HFAAEGGAFEAAKVLLAHKVSISHQDSEGNTPLHLVTCARVAELLLEHGSRASSRNSPKRQTPLHNAVIADR 390 H AA GA A VLL S+ +D G TP+HLV+ A +AELLL+ G+R N+ + PLH+A +A R Sbjct: 489 HVAAAQGALPEASVLLEAGASLEAKDYYGQTPMHLVSTAAMAELLLQFGARPLPTNAGLQ--PLHSAALAGR 558
BLAST of mRNA_M-pyrifera_M_contig93397.21564.1 vs. uniprot
Match: A0A6P6RR04_9EIME (acyl-CoA-binding domain-containing protein 2 n=2 Tax=Cyclospora cayetanensis TaxID=88456 RepID=A0A6P6RR04_9EIME) HSP 1 Score: 55.8 bits (133), Expect = 1.610e-6 Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = 1 Query: 61 DLFLTKVDPPTTGRRSGRSGLRRRIPIQSPTPDG-RNALHFAAEGGAFEAAKVLLAHKVSISHQDSEGNTPLHLVTCAR---VAELLLEHGSRASSRNS 345 D F +V T ++ + LR + S T DG ALHFAA+ G + AK+LLAH +++QD G TPLH+ A + LL + G+ + +NS Sbjct: 218 DAFCCQVASGDT--KAVEAALRENRSLVSATGDGGMTALHFAADRGHLDIAKMLLAHGADVNYQDDLGETPLHVAIAAEQMDMVALLRKAGANMALKNS 314
BLAST of mRNA_M-pyrifera_M_contig93397.21564.1 vs. uniprot
Match: A0A812SI95_9DINO (Hypothetical protein n=1 Tax=Symbiodinium necroappetens TaxID=1628268 RepID=A0A812SI95_9DINO) HSP 1 Score: 53.1 bits (126), Expect = 1.770e-5 Identity = 34/93 (36.56%), Postives = 47/93 (50.54%), Query Frame = 1 Query: 22 LHIAAQHNHAAICDLFLTKVDPPTTGRRSGRSG-------LRRRIP--IQSPTPDGRNALHFAAEGGAFEAAKVLLAHKVSISHQDSEGNTPL 273 L IAA+ NH + L K++ TT +G L +++P I + PDGR ALH AAE G E+ +VLL K + D G +PL Sbjct: 952 LDIAAKQNHTNLVQHLLPKIEDKTTALFWAAAGYPKLVEQLLQKVPSSIAAKQPDGRTALHHAAEAGDVESLRVLLRWKADLGSLDVYGASPL 1044
BLAST of mRNA_M-pyrifera_M_contig93397.21564.1 vs. uniprot
Match: A0A1Q9E8K8_SYMMI (Anaphase-promoting complex subunit 11 n=2 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9E8K8_SYMMI) HSP 1 Score: 51.6 bits (122), Expect = 6.240e-5 Identity = 33/93 (35.48%), Postives = 46/93 (49.46%), Query Frame = 1 Query: 22 LHIAAQHNHAAICDLFLTKVDPPTTGRRSGRSG-------LRRRIP--IQSPTPDGRNALHFAAEGGAFEAAKVLLAHKVSISHQDSEGNTPL 273 L IAA+ NH + L K++ TT +G L +++P I + PDGR ALH AAE G + +VLL K + D G +PL Sbjct: 3974 LDIAAKQNHTNLVQRLLPKIEDKTTALFWAAAGYPKIVEQLLQKVPSSIAAKQPDGRTALHHAAEAGDVRSLRVLLRWKADLGSLDVYGASPL 4066 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93397.21564.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93397.21564.1 >prot_M-pyrifera_M_contig93397.21564.1 ID=prot_M-pyrifera_M_contig93397.21564.1|Name=mRNA_M-pyrifera_M_contig93397.21564.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=131bp VTNPFSPLHIAAQHNHAAICDLFLTKVDPPTTGRRSGRSGLRRRIPIQSPback to top mRNA from alignment at M-pyrifera_M_contig93397:3..395- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93397.21564.1 ID=mRNA_M-pyrifera_M_contig93397.21564.1|Name=mRNA_M-pyrifera_M_contig93397.21564.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=393bp|location=Sequence derived from alignment at M-pyrifera_M_contig93397:3..395- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93397:3..395- >mRNA_M-pyrifera_M_contig93397.21564.1 ID=mRNA_M-pyrifera_M_contig93397.21564.1|Name=mRNA_M-pyrifera_M_contig93397.21564.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=786bp|location=Sequence derived from alignment at M-pyrifera_M_contig93397:3..395- (Macrocystis pyrifera P11B4 male)back to top |