mRNA_M-pyrifera_M_contig92386.21380.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92386.21380.1 vs. uniprot
Match: A0A183DR93_9BILA (ANK_REP_REGION domain-containing protein n=2 Tax=Gongylonema pulchrum TaxID=637853 RepID=A0A183DR93_9BILA) HSP 1 Score: 49.3 bits (116), Expect = 3.080e-5 Identity = 26/59 (44.07%), Postives = 38/59 (64.41%), Query Frame = 1 Query: 1 AAADNNVELVKTLLAQNPSLRNYKDNHDWQALHFASNTGAIGPVYVLLNWGADPNSSTD 177 AA + N++L+K L+A+NPSL +D + ALH A+ G + V LL+ GADP +TD Sbjct: 102 AAENGNLQLLKELMAKNPSLLTARDMDGYTALHRAAYGGHVEAVEYLLSLGADPEWTTD 160 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92386.21380.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig92386.21380.1 >prot_M-pyrifera_M_contig92386.21380.1 ID=prot_M-pyrifera_M_contig92386.21380.1|Name=mRNA_M-pyrifera_M_contig92386.21380.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bp AAADNNVELVKTLLAQNPSLRNYKDNHDWQALHFASNTGAIGPVYVLLNWback to top mRNA from alignment at M-pyrifera_M_contig92386:562..765- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig92386.21380.1 ID=mRNA_M-pyrifera_M_contig92386.21380.1|Name=mRNA_M-pyrifera_M_contig92386.21380.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=204bp|location=Sequence derived from alignment at M-pyrifera_M_contig92386:562..765- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig92386:562..765- >mRNA_M-pyrifera_M_contig92386.21380.1 ID=mRNA_M-pyrifera_M_contig92386.21380.1|Name=mRNA_M-pyrifera_M_contig92386.21380.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=408bp|location=Sequence derived from alignment at M-pyrifera_M_contig92386:562..765- (Macrocystis pyrifera P11B4 male)back to top |