mRNA_M-pyrifera_M_contig91288.21157.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91288.21157.1 vs. uniprot
Match: A0A482R6I3_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482R6I3_9ARCH) HSP 1 Score: 70.5 bits (171), Expect = 3.760e-13 Identity = 31/59 (52.54%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 1 IDWEAIDNRIQQALDADGDGRVTQADLQIHWNRAVAMLGFGLPSGAAFATAFALGLTYG 177 +DW +++ + +ALDADGDG+VT D ++H+++AV +LGF LPSG+AF AF LGL +G Sbjct: 193 MDWAKVEDHMVRALDADGDGKVTITDARLHFDKAVKVLGFSLPSGSAFVAAFLLGLRWG 251
BLAST of mRNA_M-pyrifera_M_contig91288.21157.1 vs. uniprot
Match: A0A2D4BPY0_PYTIN (Amino acid transporter n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BPY0_PYTIN) HSP 1 Score: 58.5 bits (140), Expect = 1.560e-8 Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 1 IDWEAIDNRIQQALDADGDGRVTQADLQIHWNRAVAMLGFGLPSGAAFATAFALGLT 171 I+W+ ++ + QA+D DGDG++T+ DLQI + R +AML LPS A FA F LG++ Sbjct: 321 INWQKVEKDVVQAVDPDGDGKITKKDLQIWYQRFMAMLQANLPSSAGFAGGFLLGVS 377
BLAST of mRNA_M-pyrifera_M_contig91288.21157.1 vs. uniprot
Match: F2UA61_SALR5 (Uncharacterized protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UA61_SALR5) HSP 1 Score: 48.9 bits (115), Expect = 2.070e-5 Identity = 25/59 (42.37%), Postives = 35/59 (59.32%), Query Frame = 1 Query: 1 IDWEAIDNRIQQALDADGDGRVTQADLQIHWNRAVAMLGFGLPSG-AAFATAFALGLTY 174 + W+ I++ + LD DGDG+V+QADLQ ++ M F LP+ A F F LGL Y Sbjct: 116 VHWDKIEHDVTSILDRDGDGKVSQADLQYWQHQLAKMATFQLPASMAGFGVGFGLGLKY 174
BLAST of mRNA_M-pyrifera_M_contig91288.21157.1 vs. uniprot
Match: A0A8K1C7L2_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C7L2_PYTOL) HSP 1 Score: 49.3 bits (116), Expect = 2.210e-5 Identity = 22/57 (38.60%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 1 IDWEAIDNRIQQALDADGDGRVTQADLQIHWNRAVAMLGFGLPSGAAFATAFALGLT 171 I+W ++ + +A+D DGDG++T+ DL+I + R + +L LPS A FA F +G++ Sbjct: 164 INWTKVNKDVIEAVDPDGDGKLTKKDLEIGYQRLMKILKTNLPSSAGFAGGFLVGVS 220 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91288.21157.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91288.21157.1 >prot_M-pyrifera_M_contig91288.21157.1 ID=prot_M-pyrifera_M_contig91288.21157.1|Name=mRNA_M-pyrifera_M_contig91288.21157.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=60bp IDWEAIDNRIQQALDADGDGRVTQADLQIHWNRAVAMLGFGLPSGAAFATback to top mRNA from alignment at M-pyrifera_M_contig91288:40..219+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91288.21157.1 ID=mRNA_M-pyrifera_M_contig91288.21157.1|Name=mRNA_M-pyrifera_M_contig91288.21157.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=180bp|location=Sequence derived from alignment at M-pyrifera_M_contig91288:40..219+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91288:40..219+ >mRNA_M-pyrifera_M_contig91288.21157.1 ID=mRNA_M-pyrifera_M_contig91288.21157.1|Name=mRNA_M-pyrifera_M_contig91288.21157.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=360bp|location=Sequence derived from alignment at M-pyrifera_M_contig91288:40..219+ (Macrocystis pyrifera P11B4 male)back to top |