mRNA_M-pyrifera_M_contig9106.21112.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9106.21112.1 vs. uniprot
Match: D8LS32_ECTSI (DUF667 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS32_ECTSI) HSP 1 Score: 81.3 bits (199), Expect = 7.600e-17 Identity = 32/42 (76.19%), Postives = 39/42 (92.86%), Query Frame = 1 Query: 1 MFKSAYQDGDCVEIFSPAGKNPAVEWKLTNKVARLYDKGIKG 126 MF+SAYQDGDCVE+FSPAGKNPA +WKL+ KV R+Y+KG+KG Sbjct: 1 MFQSAYQDGDCVEVFSPAGKNPAADWKLSGKVVRMYEKGVKG 42
BLAST of mRNA_M-pyrifera_M_contig9106.21112.1 vs. uniprot
Match: A0A662WTC2_9STRA (DUF667 domain-containing protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662WTC2_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 6.080e-7 Identity = 23/42 (54.76%), Postives = 28/42 (66.67%), Query Frame = 1 Query: 1 MFKSAYQDGDCVEIFSPAGKNPAVEWKLTNKVARLYDKGIKG 126 M S +Q GD VE+ S GK PA WKL K+A+ +DKGIKG Sbjct: 1373 MASSYFQGGDFVELLSAQGKAPAAAWKLQGKIAKSFDKGIKG 1414 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9106.21112.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig9106.21112.1 >prot_M-pyrifera_M_contig9106.21112.1 ID=prot_M-pyrifera_M_contig9106.21112.1|Name=mRNA_M-pyrifera_M_contig9106.21112.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp MFKSAYQDGDCVEIFSPAGKNPAVEWKLTNKVARLYDKGIKG*back to top mRNA from alignment at M-pyrifera_M_contig9106:9562..9690- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig9106.21112.1 ID=mRNA_M-pyrifera_M_contig9106.21112.1|Name=mRNA_M-pyrifera_M_contig9106.21112.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=129bp|location=Sequence derived from alignment at M-pyrifera_M_contig9106:9562..9690- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig9106:9562..9690- >mRNA_M-pyrifera_M_contig9106.21112.1 ID=mRNA_M-pyrifera_M_contig9106.21112.1|Name=mRNA_M-pyrifera_M_contig9106.21112.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig9106:9562..9690- (Macrocystis pyrifera P11B4 male)back to top |