mRNA_M-pyrifera_M_contig84368.19676.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84368.19676.1 vs. uniprot
Match: A0A819YKZ9_9BILA (Hypothetical protein n=16 Tax=Rotaria socialis TaxID=392032 RepID=A0A819YKZ9_9BILA) HSP 1 Score: 51.6 bits (122), Expect = 7.720e-5 Identity = 39/138 (28.26%), Postives = 63/138 (45.65%), Query Frame = 1 Query: 7 GPAEASGMIEPGDRLVSADGRPLQGLPLAEVLAALQEVGNRARWVLEFQPG------RGEAQFRPSGSDFSVVLNALEPLGAVLDERLSGAESGFGAFAGSSGVPLGESRTKSQLA-RARVVSVGDRLVGIDGISLLG 399 G AE SG+++PGDR++S +G+ L+G+ L + ++E NR + +EF G Q + + + L+ P A DE VP+ + +A R ++ GDRL+ ID SL G Sbjct: 579 GVAERSGILQPGDRILSINGQQLEGMTLEDARTIIKESNNRMHFEIEFDVADSVMLSSGTCQVKILRKNLDLGLSVTYPRXARTDE-----------------VPIINDVKRGSIAYRCGMIQSGDRLLSIDTHSLRG 699 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84368.19676.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84368.19676.1 >prot_M-pyrifera_M_contig84368.19676.1 ID=prot_M-pyrifera_M_contig84368.19676.1|Name=mRNA_M-pyrifera_M_contig84368.19676.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=131bp MIEPGDRLVSADGRPLQGLPLAEVLAALQEVGNRARWVLEFQPGRGEAQFback to top mRNA from alignment at M-pyrifera_M_contig84368:44..508+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84368.19676.1 ID=mRNA_M-pyrifera_M_contig84368.19676.1|Name=mRNA_M-pyrifera_M_contig84368.19676.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=465bp|location=Sequence derived from alignment at M-pyrifera_M_contig84368:44..508+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84368:44..508+ >mRNA_M-pyrifera_M_contig84368.19676.1 ID=mRNA_M-pyrifera_M_contig84368.19676.1|Name=mRNA_M-pyrifera_M_contig84368.19676.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=786bp|location=Sequence derived from alignment at M-pyrifera_M_contig84368:44..508+ (Macrocystis pyrifera P11B4 male)back to top |