mRNA_M-pyrifera_M_contig84004.19599.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A8J5FUY6_ZINOF (Molybdopterin synthase sulfur carrier subunit n=2 Tax=Zingiber officinale TaxID=94328 RepID=A0A8J5FUY6_ZINOF) HSP 1 Score: 85.5 bits (210), Expect = 1.490e-19 Identity = 42/84 (50.00%), Postives = 58/84 (69.05%), Query Frame = 1 Query: 49 IKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 IK++VLFFAR+RDLT V E LE+ D ST G L+ +FP+L + VL++N EYA ES++L+ DE+A+IPP+SGG Sbjct: 27 IKIKVLFFARARDLTGVSETSLEMPDGSTAGDCMRNLLVKFPSLQEIYNS---MVLAINEEYAAESTLLTSKDELAIIPPISGG 107
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A8B8JLV4_ABRPR (Molybdopterin synthase sulfur carrier subunit n=1 Tax=Abrus precatorius TaxID=3816 RepID=A0A8B8JLV4_ABRPR) HSP 1 Score: 83.6 bits (205), Expect = 7.640e-19 Identity = 44/92 (47.83%), Postives = 61/92 (66.30%), Query Frame = 1 Query: 25 HSNLSTPMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 HS + M+K++VLFFAR+RDLT + E+ LEV ST L+T FP+L + RG VL+LN EY ES+++ DE+A+IPP+SGG Sbjct: 15 HSKKESSMVKIKVLFFARARDLTGLSEMPLEVSSGSTTHDCLKKLLTNFPSLEEI-RG--CMVLALNEEYTTESAIVKDTDELAIIPPISGG 103
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: I3T2W6_LOTJA (Molybdopterin synthase sulfur carrier subunit n=1 Tax=Lotus japonicus TaxID=34305 RepID=I3T2W6_LOTJA) HSP 1 Score: 82.4 bits (202), Expect = 2.180e-18 Identity = 40/93 (43.01%), Postives = 61/93 (65.59%), Query Frame = 1 Query: 22 LHSNLSTPMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 +HS + ++K++VLFFAR+RDLT + E+ LEV ST L+ +FP+L + + VL+LN EY ES+++ DE+A+IPP+SGG Sbjct: 14 MHSKKESALVKIKVLFFARARDLTGLSEVPLEVTSGSTTRDCLKKLLAQFPSLEEI---QGCMVLALNEEYTTESTIVKDTDELAIIPPISGG 103
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A6P5GRX2_ANACO (Molybdopterin synthase sulfur carrier subunit n=2 Tax=Ananas comosus TaxID=4615 RepID=A0A6P5GRX2_ANACO) HSP 1 Score: 83.2 bits (204), Expect = 2.450e-18 Identity = 41/84 (48.81%), Postives = 58/84 (69.05%), Query Frame = 1 Query: 49 IKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 I+++VLFFAR+RDLT + E +E+ + ST G L+T+FP L + + VL+LN EYA ES+VL DE+A+IPP+SGG Sbjct: 54 IEIKVLFFARARDLTGLSETSIELPEGSTAGDCMSKLLTKFPNLEEI---SNSMVLALNEEYAPESTVLKNRDELAIIPPISGG 134
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A8J5F8M5_ZINOF (Molybdopterin synthase sulfur carrier subunit n=1 Tax=Zingiber officinale TaxID=94328 RepID=A0A8J5F8M5_ZINOF) HSP 1 Score: 85.5 bits (210), Expect = 4.100e-18 Identity = 42/84 (50.00%), Postives = 58/84 (69.05%), Query Frame = 1 Query: 49 IKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 IK++VLFFAR+RDLT V E LE+ D ST G L+ +FP+L + VL++N EYA ES++L+ DE+A+IPP+SGG Sbjct: 176 IKIKVLFFARARDLTGVSETSLEMPDGSTAGDCMRNLLVKFPSLQEIYNS---MVLAINEEYAAESTLLTSKDELAIIPPISGG 256
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A2I4G4U9_JUGRE (Molybdopterin synthase sulfur carrier subunit n=3 Tax=Juglandaceae TaxID=16714 RepID=A0A2I4G4U9_JUGRE) HSP 1 Score: 81.3 bits (199), Expect = 6.550e-18 Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 43 PMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 P +K++VLFFAR+RDLT + E+ LEV S+ + L+ RFP L + VL+LN EY ES+++ + DE+A+IPP+SGG Sbjct: 23 PSVKIKVLFFARARDLTSLTEMPLEVPSGSSADDCLNDLVARFPGLEEI---RECMVLALNEEYTTESTIVKEKDELAIIPPISGG 105
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A5P1FG10_ASPOF (Molybdopterin synthase sulfur carrier subunit n=2 Tax=Asparagus officinalis TaxID=4686 RepID=A0A5P1FG10_ASPOF) HSP 1 Score: 81.3 bits (199), Expect = 6.720e-18 Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 1 Query: 46 MIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 +I+++VLFFAR+RDLT EI L++ ST G L+T+FP L + VL+LN EYA E++VL DE+A+IPP+SGG Sbjct: 25 LIEIKVLFFARARDLTGSKEIPLKLPAGSTAGDCMSKLLTQFPQLGEIYNS---VVLALNEEYAPETAVLKNKDELAIIPPISGG 106
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A7C9CUX5_OPUST (Molybdopterin synthase sulfur carrier subunit n=1 Tax=Opuntia streptacantha TaxID=393608 RepID=A0A7C9CUX5_OPUST) HSP 1 Score: 80.9 bits (198), Expect = 8.570e-18 Identity = 43/92 (46.74%), Postives = 60/92 (65.22%), Query Frame = 1 Query: 25 HSNLSTPMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 H ++K++VLFFAR+RDLT + E+ LEV +T D L+T FP L + RG VL+LN EYA ES+++ DE+A+IPP+SGG Sbjct: 14 HEMSEKSLVKLKVLFFARARDLTGLTEMPLEVTSGTTAHGCLDKLVTLFPGLEEI-RG--CMVLALNEEYASESAIVKDKDELAIIPPISGG 102
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A4S8K7D7_MUSBA (Molybdopterin synthase sulfur carrier subunit n=4 Tax=Musaceae TaxID=4637 RepID=A0A4S8K7D7_MUSBA) HSP 1 Score: 80.9 bits (198), Expect = 1.030e-17 Identity = 42/86 (48.84%), Postives = 56/86 (65.12%), Query Frame = 1 Query: 43 PMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 P IK++VLFFAR+RDLT E+ LE+ D ST + L+ FP L + VL+LN EYA ES++L DE+A+IPP+SGG Sbjct: 27 PYIKIKVLFFARARDLTGSTELCLEMPDGSTARDCMNKLLIEFPNLREIYNS---MVLALNEEYAPESTILRNKDELAIIPPISGG 109
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Match: A0A2I0VXW9_9ASPA (Molybdopterin synthase sulfur carrier subunit n=2 Tax=Dendrobium catenatum TaxID=906689 RepID=A0A2I0VXW9_9ASPA) HSP 1 Score: 80.9 bits (198), Expect = 1.210e-17 Identity = 38/88 (43.18%), Postives = 57/88 (64.77%), Query Frame = 1 Query: 37 STPMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQDTLITRFPALSALLRGESRAVLSLNGEYAEESSVLSKDDEIAVIPPVSGG 300 S P +K+ VLFFA++R++T +P+I L+V S+ G L+T+FP L + V +LN EYA +S +L DE+A+IPP+SGG Sbjct: 31 SEPSVKIEVLFFAKAREITGLPDISLQVPPSSSAGDCLKILLTKFPRLEEICNS---IVFALNEEYAPDSIILKNGDELAIIPPISGG 115 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84004.19599.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84004.19599.1 >prot_M-pyrifera_M_contig84004.19599.1 ID=prot_M-pyrifera_M_contig84004.19599.1|Name=mRNA_M-pyrifera_M_contig84004.19599.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=101bp MTYIIFQLHSNLSTPMIKVRVLFFARSRDLTKVPEIELEVKDDSTLGSIQback to top mRNA from alignment at M-pyrifera_M_contig84004:507..809+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84004.19599.1 ID=mRNA_M-pyrifera_M_contig84004.19599.1|Name=mRNA_M-pyrifera_M_contig84004.19599.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=303bp|location=Sequence derived from alignment at M-pyrifera_M_contig84004:507..809+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84004:507..809+ >mRNA_M-pyrifera_M_contig84004.19599.1 ID=mRNA_M-pyrifera_M_contig84004.19599.1|Name=mRNA_M-pyrifera_M_contig84004.19599.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=606bp|location=Sequence derived from alignment at M-pyrifera_M_contig84004:507..809+ (Macrocystis pyrifera P11B4 male)back to top |