mRNA_M-pyrifera_M_contig8065.18877.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8065.18877.1 vs. uniprot
Match: A0A6H5K7I3_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K7I3_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 2.300e-6 Identity = 27/87 (31.03%), Postives = 48/87 (55.17%), Query Frame = 1 Query: 49 TGPEVFMLLLRLLSNHFDCTDTGVSYTKLNNFGVPNGTPFCDSSRAFRGVVSAATGTGRGLAPGMEVVLEVVRTAVNKQYPSLTPTL 309 +GP + LL+LL++ ++ KL +FGVPNGTP+ F+ + + + R AP + +V +R A+ +QYP++ +L Sbjct: 138 SGPSAYRRLLQLLTDEWEPKRFNRGIDKLQDFGVPNGTPYSKFVTKFKALAMSEIASHRAFAPDLRMVQRALRDALLEQYPNVLSSL 224
BLAST of mRNA_M-pyrifera_M_contig8065.18877.1 vs. uniprot
Match: A0A6H5JDL4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDL4_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 5.390e-6 Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1 Query: 1 YGRYQQEVSRALAA-GSTGPEVFMLLLRLLSNHFDCTDTGVSYTKLNNFGVPNGTPFCDSSRAFRGVVSAATGTGRGLAPGMEVVLEVVRTAVNKQYPSLTPTL 309 YG ++V R L TGP + LL+LL++ ++ KL +FGVPNGTP+ F+ + + + R A + +V +R A+ +QY ++ +L Sbjct: 58 YGPSSRQVKRFLETKDKTGPSAYRRLLKLLADEWEPKGFNRGIDKLQDFGVPNGTPYSKFVTKFKALAMSELASHRAFAQDLRMVQRALRDALLEQYLNVLSSL 161 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8065.18877.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8065.18877.1 >prot_M-pyrifera_M_contig8065.18877.1 ID=prot_M-pyrifera_M_contig8065.18877.1|Name=mRNA_M-pyrifera_M_contig8065.18877.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bp YGRYQQEVSRALAAGSTGPEVFMLLLRLLSNHFDCTDTGVSYTKLNNFGVback to top mRNA from alignment at M-pyrifera_M_contig8065:10531..10856+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8065.18877.1 ID=mRNA_M-pyrifera_M_contig8065.18877.1|Name=mRNA_M-pyrifera_M_contig8065.18877.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=326bp|location=Sequence derived from alignment at M-pyrifera_M_contig8065:10531..10856+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8065:10531..10856+ >mRNA_M-pyrifera_M_contig8065.18877.1 ID=mRNA_M-pyrifera_M_contig8065.18877.1|Name=mRNA_M-pyrifera_M_contig8065.18877.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=648bp|location=Sequence derived from alignment at M-pyrifera_M_contig8065:10531..10856+ (Macrocystis pyrifera P11B4 male)back to top |