mRNA_M-pyrifera_M_contig79265.18605.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79265.18605.1 vs. uniprot
Match: Q54BY9_DICDI (Uncharacterized protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=Q54BY9_DICDI) HSP 1 Score: 54.3 bits (129), Expect = 1.530e-6 Identity = 27/85 (31.76%), Postives = 51/85 (60.00%), Query Frame = 1 Query: 10 VRKRVATELLETEKNYVKNMEQVIQLLVGPVLNASKQGMRIMKDSEFFSCFANLPQLTAHHASFCAKLTERIEENWTDEVTIGDI 264 +R+R+A ELL TEK+YV N++ +I + + P++N + R++ SE F N +L ++ + +++ NW+ + TIGD+ Sbjct: 286 MRRRIAQELLSTEKSYVYNLKLIIDIFIRPLINFNSIEQRVLSVSEISGVFGNWERLYKINSDLLVLIQCKLD-NWSIDQTIGDL 369
BLAST of mRNA_M-pyrifera_M_contig79265.18605.1 vs. uniprot
Match: UPI002025D51D (LOW QUALITY PROTEIN: FYVE, RhoGEF and PH domain-containing protein 2 n=1 Tax=Sphaerodactylus townsendi TaxID=933632 RepID=UPI002025D51D) HSP 1 Score: 50.4 bits (119), Expect = 3.490e-5 Identity = 29/88 (32.95%), Postives = 47/88 (53.41%), Query Frame = 1 Query: 1 QNTVRKRVATELLETEKNYVKNMEQVIQLLVGPVLNASKQGMRIMKDSEFFSCFANLPQLTAHHASFCAKLTERIEENWTDEVTIGDI 264 Q++ K++A ELLETEK YV + + Q+ ++NA++ G I +D F+N+ + H+ F ++ ENW IGDI Sbjct: 110 QDSEEKKIALELLETEKAYVGRLHLLDQVFFSELMNAARNGKTIPEDVVKM-IFSNISSIYQFHSQFFLPELQKRMENWDSNSRIGDI 196
BLAST of mRNA_M-pyrifera_M_contig79265.18605.1 vs. uniprot
Match: A0A1X7UJQ9_AMPQE (DH domain-containing protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7UJQ9_AMPQE) HSP 1 Score: 50.1 bits (118), Expect = 3.910e-5 Identity = 30/88 (34.09%), Postives = 45/88 (51.14%), Query Frame = 1 Query: 1 QNTVRKRVATELLETEKNYVKNMEQVIQLLVGPVLNASKQGMRIMKDSEFFSCFANLPQLTAHHASFCAKLTERIEENWTDEVTIGDI 264 Q+T R + ELL TEKN+VK + + ++ L P ++G +++ + S F N+P + H L ERI NW IGDI Sbjct: 101 QDTARYHIVKELLTTEKNFVKILNEFMKPLATP----GQRGGQLLTNENVKSIFGNIPDILRVHTDIMNGLEERIN-NWESNTCIGDI 183 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79265.18605.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79265.18605.1 >prot_M-pyrifera_M_contig79265.18605.1 ID=prot_M-pyrifera_M_contig79265.18605.1|Name=mRNA_M-pyrifera_M_contig79265.18605.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=88bp QNTVRKRVATELLETEKNYVKNMEQVIQLLVGPVLNASKQGMRIMKDSEFback to top mRNA from alignment at M-pyrifera_M_contig79265:6..269- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79265.18605.1 ID=mRNA_M-pyrifera_M_contig79265.18605.1|Name=mRNA_M-pyrifera_M_contig79265.18605.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=264bp|location=Sequence derived from alignment at M-pyrifera_M_contig79265:6..269- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79265:6..269- >mRNA_M-pyrifera_M_contig79265.18605.1 ID=mRNA_M-pyrifera_M_contig79265.18605.1|Name=mRNA_M-pyrifera_M_contig79265.18605.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=528bp|location=Sequence derived from alignment at M-pyrifera_M_contig79265:6..269- (Macrocystis pyrifera P11B4 male)back to top |