mRNA_M-pyrifera_M_contig7858.18461.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7858.18461.1 vs. uniprot
Match: D8LBB5_ECTSI (Essential abundant protein involved in regulation of transcription n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBB5_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 2.140e-5 Identity = 22/25 (88.00%), Postives = 25/25 (100.00%), Query Frame = 3 Query: 51 LELWSADEDYAYLASDRLADSVARE 125 +ELWSADEDYAYLA++RLADSVARE Sbjct: 2307 VELWSADEDYAYLAAERLADSVARE 2331 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7858.18461.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7858.18461.1 >prot_M-pyrifera_M_contig7858.18461.1 ID=prot_M-pyrifera_M_contig7858.18461.1|Name=mRNA_M-pyrifera_M_contig7858.18461.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=109bp MGPADGPGVPQALARTSLSSGVLMRTMRTLRPIVWRTLWRGSRKLCRLLGback to top mRNA from alignment at M-pyrifera_M_contig7858:5635..5961+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7858.18461.1 ID=mRNA_M-pyrifera_M_contig7858.18461.1|Name=mRNA_M-pyrifera_M_contig7858.18461.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=327bp|location=Sequence derived from alignment at M-pyrifera_M_contig7858:5635..5961+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7858:5635..5961+ >mRNA_M-pyrifera_M_contig7858.18461.1 ID=mRNA_M-pyrifera_M_contig7858.18461.1|Name=mRNA_M-pyrifera_M_contig7858.18461.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=654bp|location=Sequence derived from alignment at M-pyrifera_M_contig7858:5635..5961+ (Macrocystis pyrifera P11B4 male)back to top |