mRNA_M-pyrifera_M_contig77990.18345.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77990.18345.1 vs. uniprot
Match: A0A5B1QR39_9AGAM (ARM repeat-containing protein n=1 Tax=Dentipellis sp. KUC8613 TaxID=1883078 RepID=A0A5B1QR39_9AGAM) HSP 1 Score: 54.3 bits (129), Expect = 8.870e-6 Identity = 31/136 (22.79%), Postives = 68/136 (50.00%), Query Frame = 1 Query: 7 EVEGVLDAFLRATPDTFTAIDGEVQSMCTHEGVPVILAGMLVDGASRAQVRQLAGSLIRTQVIEKHWTRFTE---------EERSEVRSILLQGLRGEFSWLRTACARALGAISENDFPSTWPGFLEEVGKVLDEG 387 ++ +L + L + P+ A + ++ T+ + LA ++ + +RQ++ ++ + +E+HW+ F + E +S++R+I+ QGL +R+ CA L I+ +D+P +P L + +L G Sbjct: 6 DIAQLLTSTLNSDPNVRIAAELKLSESLTNPQSALSLAQLIHAQDADLSLRQISSHILLRKYVEEHWSPFFQQFKGNAPPVEVKSQIRTIVFQGLSDPIRKIRSLCAHTLSTIAMSDWPDEYPDLLTSLLGLLSSG 141 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77990.18345.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77990.18345.1 >prot_M-pyrifera_M_contig77990.18345.1 ID=prot_M-pyrifera_M_contig77990.18345.1|Name=mRNA_M-pyrifera_M_contig77990.18345.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=140bp MDEVEGVLDAFLRATPDTFTAIDGEVQSMCTHEGVPVILAGMLVDGASRAback to top mRNA from alignment at M-pyrifera_M_contig77990:6..425- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77990.18345.1 ID=mRNA_M-pyrifera_M_contig77990.18345.1|Name=mRNA_M-pyrifera_M_contig77990.18345.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=420bp|location=Sequence derived from alignment at M-pyrifera_M_contig77990:6..425- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77990:6..425- >mRNA_M-pyrifera_M_contig77990.18345.1 ID=mRNA_M-pyrifera_M_contig77990.18345.1|Name=mRNA_M-pyrifera_M_contig77990.18345.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=840bp|location=Sequence derived from alignment at M-pyrifera_M_contig77990:6..425- (Macrocystis pyrifera P11B4 male)back to top |