mRNA_M-pyrifera_M_contig75158.17750.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75158.17750.1 vs. uniprot
Match: A0A5A8E0M8_CAFRO (Galactosylceramidase n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8E0M8_CAFRO) HSP 1 Score: 73.6 bits (179), Expect = 4.150e-13 Identity = 40/93 (43.01%), Postives = 53/93 (56.99%), Query Frame = 1 Query: 1 CLGVDGKDPSSGFPNVALVECGDSPLTLTMLSTQQIKDTST---------GYCLDITASGTTPGSNVELYTCDSGHVYPNQQYEFATDGALMN 252 CLGV GKDPSSG+PNVALV C P + Q+ T+T GYC+D+T + G+NVELY C+ G NQ++ DG ++N Sbjct: 726 CLGVSGKDPSSGYPNVALVAC--DPQDASQAWDLQLNSTTTQFVNGFENKGYCMDVTGQASWAGANVELYECNGGD---NQKFVLDEDGRIVN 813
BLAST of mRNA_M-pyrifera_M_contig75158.17750.1 vs. uniprot
Match: UPI000ADA32E1 (ricin-type beta-trefoil lectin domain protein n=1 Tax=Demequina aestuarii TaxID=327095 RepID=UPI000ADA32E1) HSP 1 Score: 56.2 bits (134), Expect = 5.100e-7 Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 1 Query: 1 CLGVDGKDPSSGFPNVALVECGDSPLTLTMLSTQQIKDTSTGYCLDITASGTTPGSNVELYTCDSGHVYPNQQYEFATDGALMNMNSHLCV 273 C+ V G + + +V + +C + ST T+ G CLDI +GTTPG+ V+LY C+S QQ+ DG+L+N S LC+ Sbjct: 577 CVDVHGANTGTNGTSVVVEDCMREANDQSWWSTSDGSLTTLGRCLDIVGNGTTPGTPVQLYDCNSSG---GQQWVQQDDGSLLNPQSGLCL 664 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75158.17750.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75158.17750.1 >prot_M-pyrifera_M_contig75158.17750.1 ID=prot_M-pyrifera_M_contig75158.17750.1|Name=mRNA_M-pyrifera_M_contig75158.17750.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=100bp CLGVDGKDPSSGFPNVALVECGDSPLTLTMLSTQQIKDTSTGYCLDITASback to top mRNA from alignment at M-pyrifera_M_contig75158:127..426+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75158.17750.1 ID=mRNA_M-pyrifera_M_contig75158.17750.1|Name=mRNA_M-pyrifera_M_contig75158.17750.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=300bp|location=Sequence derived from alignment at M-pyrifera_M_contig75158:127..426+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75158:127..426+ >mRNA_M-pyrifera_M_contig75158.17750.1 ID=mRNA_M-pyrifera_M_contig75158.17750.1|Name=mRNA_M-pyrifera_M_contig75158.17750.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=600bp|location=Sequence derived from alignment at M-pyrifera_M_contig75158:127..426+ (Macrocystis pyrifera P11B4 male)back to top |