mRNA_M-pyrifera_M_contig72388.17209.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A7S0HW18_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Phaeocystis antarctica TaxID=33657 RepID=A0A7S0HW18_9EUKA) HSP 1 Score: 55.8 bits (133), Expect = 9.140e-8 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLLVDDMVGAF 141 YKV +L+VK VR K YL+KW GY +E +WEPE L D++ AF Sbjct: 53 YKVQAILEVKKVRGKPQYLIKWEGYEEDENSWEPEDNLDCQDLLEAF 99
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: L2GLU5_VITCO (Chromo domain-containing protein n=1 Tax=Vittaforma corneae (strain ATCC 50505) TaxID=993615 RepID=L2GLU5_VITCO) HSP 1 Score: 54.7 bits (130), Expect = 9.360e-8 Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLLVDDMVGAFND 147 + V+ +LD +VV+ KK YL+KW GYP E TWE E L+ ++M+ ++ D Sbjct: 12 FDVERILDDRVVKGKKQYLIKWIGYPDSENTWEYEENLMCEEMLKSYMD 60
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A1Y3N284_PIRSE (Chromo domain-containing protein n=1 Tax=Piromyces sp. (strain E2) TaxID=73868 RepID=A0A1Y3N284_PIRSE) HSP 1 Score: 52.4 bits (124), Expect = 1.430e-7 Identity = 20/50 (40.00%), Postives = 34/50 (68.00%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLLVDDMVGAFNDN 150 Y+V+ +LD + K+ YL+KW GYP+ +A+WEP+ L ++++ FN N Sbjct: 32 YEVEEILDKRKHYGKEQYLIKWKGYPLSDASWEPKENLNCEELLKEFNKN 81
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A1J9P6V5_9EURO (Chromo domain-containing protein n=1 Tax=Emergomyces pasteurianus Ep9510 TaxID=1447872 RepID=A0A1J9P6V5_9EURO) HSP 1 Score: 54.3 bits (129), Expect = 3.900e-7 Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPE 105 Y+V+ +L K++ + +VYLVKWAGYP+E ATWEPE Sbjct: 28 YEVEAILAQKILSNGEVYLVKWAGYPLERATWEPE 62
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: S7XVU8_SPRLO (Chromobox protein n=1 Tax=Spraguea lophii (strain 42_110) TaxID=1358809 RepID=S7XVU8_SPRLO) HSP 1 Score: 52.0 bits (123), Expect = 7.070e-7 Identity = 19/50 (38.00%), Postives = 33/50 (66.00%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLLVDDMVGAFNDN 150 Y V+ ++DV+VV+ +K YL+KW GYP E TW+ + + D++ F ++ Sbjct: 7 YNVEKIVDVRVVKGRKQYLIKWEGYPDSENTWQFASDIFCKDLITVFEND 56
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A0K0E390_STRER (Uncharacterized protein n=1 Tax=Strongyloides stercoralis TaxID=6248 RepID=A0A0K0E390_STRER) HSP 1 Score: 53.5 bits (127), Expect = 7.210e-7 Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGL 114 Y V+ +LD++V KK+Y +KW GYPV+E TWEP + L Sbjct: 33 YVVEDILDIRVKNGKKLYKIKWEGYPVDECTWEPASNL 70
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: E9CT96_COCPS (Chromo domain-containing protein n=7 Tax=Coccidioides TaxID=5500 RepID=E9CT96_COCPS) HSP 1 Score: 53.5 bits (127), Expect = 7.290e-7 Identity = 20/35 (57.14%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPE 105 Y+V+C+L +V K++YLVKWAGYP+E +TWE E Sbjct: 26 YEVECILAQRVYHGKEMYLVKWAGYPMERSTWETE 60
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A7S2N5D7_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2N5D7_9EUKA) HSP 1 Score: 53.1 bits (126), Expect = 9.860e-7 Identity = 26/54 (48.15%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGL-LVDDMVGAFNDNMQA 159 ++V+ ++D +VV+ KK YLVKW GY +E TWEP A L V DMV F +A Sbjct: 9 FEVEKIVDSRVVKKKKEYLVKWKGYSAKENTWEPIAHLETVQDMVDEFEGKGKA 62
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A3E2GRS2_SCYLI (Chromo domain-containing protein (Fragment) n=1 Tax=Scytalidium lignicola TaxID=5539 RepID=A0A3E2GRS2_SCYLI) HSP 1 Score: 52.8 bits (125), Expect = 1.020e-6 Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLL-VDDMVGAFN-DNMQ 156 Y+V+ ++D K+ K+ YLVKWAGYP E TWEPE+ L V M+ F DN++ Sbjct: 185 YQVEAIVDSKLKDGKRHYLVKWAGYPKSENTWEPESHLTKVRAMIKQFRRDNLE 238
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Match: A0A2B7XBB4_9EURO (Chromo domain-containing protein n=1 Tax=Blastomyces parvus TaxID=2060905 RepID=A0A2B7XBB4_9EURO) HSP 1 Score: 52.0 bits (123), Expect = 2.560e-6 Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 1 Query: 1 YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPE 105 Y V+C+L K + + YLVKW GYP+E ATWEPE Sbjct: 31 YDVECILAQKTLSTGDAYLVKWGGYPLERATWEPE 65 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72388.17209.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72388.17209.1 >prot_M-pyrifera_M_contig72388.17209.1 ID=prot_M-pyrifera_M_contig72388.17209.1|Name=mRNA_M-pyrifera_M_contig72388.17209.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bp YKVDCLLDVKVVRSKKVYLVKWAGYPVEEATWEPEAGLLVDDMVGAFNDNback to top mRNA from alignment at M-pyrifera_M_contig72388:758..919+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72388.17209.1 ID=mRNA_M-pyrifera_M_contig72388.17209.1|Name=mRNA_M-pyrifera_M_contig72388.17209.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=162bp|location=Sequence derived from alignment at M-pyrifera_M_contig72388:758..919+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72388:758..919+ >mRNA_M-pyrifera_M_contig72388.17209.1 ID=mRNA_M-pyrifera_M_contig72388.17209.1|Name=mRNA_M-pyrifera_M_contig72388.17209.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig72388:758..919+ (Macrocystis pyrifera P11B4 male)back to top |