mRNA_M-pyrifera_M_contig70505.16831.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70505.16831.1 vs. uniprot
Match: A0A843FSZ7_9EURY (Uncharacterized protein n=1 Tax=Methanobrevibacter sp. TaxID=66852 RepID=A0A843FSZ7_9EURY) HSP 1 Score: 61.6 bits (148), Expect = 1.350e-9 Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 1 Query: 37 YFLNLDKKFFVDLKTYNR--EVSPTILL-ACGNGDGGGDYFGEDKELVGSWAGDHVGVADKVPED 222 Y +N KK F+ + + P LL A GNG GGGDY+G + EL+GSWA D +GVA+++P+D Sbjct: 125 YIINFTKKMFIRIPKRGECLTIHPLPLLCADGNGRGGGDYYGSNMELIGSWAYDKIGVANEIPDD 189
BLAST of mRNA_M-pyrifera_M_contig70505.16831.1 vs. uniprot
Match: A0A6C0K639_9ZZZZ (Uncharacterized protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0K639_9ZZZZ) HSP 1 Score: 60.1 bits (144), Expect = 3.340e-9 Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = 1 Query: 34 RYFLNLDKKFFVDLKTYNREVSPT-ILLACGNGDGGGDYFGEDKELVGSWAGDHVGVADKVPEDGDWTELKPCF 252 +Y LN KK F+D K +E+ P IL+A GNG GGGDY+G+ KE G+WA D + V + ++ EL C Sbjct: 111 QYILNHTKKLFIDKKKI-KEIHPLPILVAEGNGRGGGDYYGDGKEHSGTWARDVISVNNSTEGYEEFAELNNCI 183
BLAST of mRNA_M-pyrifera_M_contig70505.16831.1 vs. uniprot
Match: A0A1Y3TPQ1_9FIRM (Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1Y3TPQ1_9FIRM) HSP 1 Score: 51.2 bits (121), Expect = 1.080e-5 Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 76 KTYNREVSP-TILLACGNGDGGGDYFGEDKELVGSWAGDH--VGVADKVPEDGDWTELKPCF 252 K + ++P +++LA GNG GGGDY+ + ELVGSWA D + + D P+ D+ EL+P F Sbjct: 137 KILSATIAPLSLMLALGNGQGGGDYYAHNHELVGSWAKDSSSLEITDVKPKS-DYKELQPEF 197 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70505.16831.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig70505.16831.1 >prot_M-pyrifera_M_contig70505.16831.1 ID=prot_M-pyrifera_M_contig70505.16831.1|Name=mRNA_M-pyrifera_M_contig70505.16831.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=84bp KLKATAWKDVKRYFLNLDKKFFVDLKTYNREVSPTILLACGNGDGGGDYFback to top mRNA from alignment at M-pyrifera_M_contig70505:34..285+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig70505.16831.1 ID=mRNA_M-pyrifera_M_contig70505.16831.1|Name=mRNA_M-pyrifera_M_contig70505.16831.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=252bp|location=Sequence derived from alignment at M-pyrifera_M_contig70505:34..285+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig70505:34..285+ >mRNA_M-pyrifera_M_contig70505.16831.1 ID=mRNA_M-pyrifera_M_contig70505.16831.1|Name=mRNA_M-pyrifera_M_contig70505.16831.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=504bp|location=Sequence derived from alignment at M-pyrifera_M_contig70505:34..285+ (Macrocystis pyrifera P11B4 male)back to top |