mRNA_M-pyrifera_M_contig70043.16760.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70043.16760.1 vs. uniprot
Match: A0A7L2RD66_9PASS (MORN5 protein (Fragment) n=1 Tax=Neodrepanis coruscans TaxID=254563 RepID=A0A7L2RD66_9PASS) HSP 1 Score: 50.8 bits (120), Expect = 7.000e-6 Identity = 19/45 (42.22%), Postives = 24/45 (53.33%), Query Frame = 1 Query: 100 GLILVRAPNGATYQGWMWKGVRHGRGRLLYKDGSMYVGTWSNGVP 234 G + P G Y+GW+W G+ HG G LL+ G Y W GVP Sbjct: 4 GYGWYKLPTGTEYRGWLWDGMFHGPGELLFSTGGKYQALWDRGVP 48
BLAST of mRNA_M-pyrifera_M_contig70043.16760.1 vs. uniprot
Match: A0A8J2EF92_9DINO (Hypothetical protein n=1 Tax=Amoebophrya sp. A25 TaxID=1410381 RepID=A0A8J2EF92_9DINO) HSP 1 Score: 50.8 bits (120), Expect = 2.130e-5 Identity = 20/42 (47.62%), Postives = 28/42 (66.67%), Query Frame = 1 Query: 121 PNGATYQGWMWKGVRHGRGRLLYKDGSMYVGTWSNGVPHGLG 246 P+G+ Y+GWM G +HG GR L DGS+Y G + G+ +G G Sbjct: 9779 PDGSRYEGWMMNGKKHGNGRYLLADGSIYDGQFREGIVNGYG 9820
BLAST of mRNA_M-pyrifera_M_contig70043.16760.1 vs. uniprot
Match: A0A0R3TMV0_RODNA (MORN repeat-containing protein 5 n=1 Tax=Rodentolepis nana TaxID=102285 RepID=A0A0R3TMV0_RODNA) HSP 1 Score: 48.5 bits (114), Expect = 7.090e-5 Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 100 GLILVRAPNGATYQGWMWKGVRHGRGRLLYKDGSMYVGTWSNGVP 234 G+ + P+G Y+G M G+ HG G++++ DG +Y GT+SNG P Sbjct: 3 GMGRYKLPSGNMYEGEMKDGMYHGNGKIIFPDGGIYSGTFSNGYP 47
BLAST of mRNA_M-pyrifera_M_contig70043.16760.1 vs. uniprot
Match: A0A835Y0E2_9CHLO (1-phosphatidylinositol-4-phosphate 5-kinase n=1 Tax=Edaphochlamys debaryana TaxID=47281 RepID=A0A835Y0E2_9CHLO) HSP 1 Score: 49.3 bits (116), Expect = 7.250e-5 Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 1 Query: 85 ADDYSGLILVRAPNGATYQG-WMWKGVRHGRGRLLYKDGSMYVGTWSNGVPH 237 ADDY G+ NG TY G W G+ G G+ KDGS+Y GTW +G+ H Sbjct: 2 ADDYFGVRSKTFSNGDTYTGTWSPAGLPDGEGKYTRKDGSIYDGTWKDGMRH 53 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70043.16760.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig70043.16760.1 >prot_M-pyrifera_M_contig70043.16760.1 ID=prot_M-pyrifera_M_contig70043.16760.1|Name=mRNA_M-pyrifera_M_contig70043.16760.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bp MRRKDHWGVFLTADGWHFEGAGVDNHFAADDYSGLILVRAPNGATYQGWMback to top mRNA from alignment at M-pyrifera_M_contig70043:731..976+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig70043.16760.1 ID=mRNA_M-pyrifera_M_contig70043.16760.1|Name=mRNA_M-pyrifera_M_contig70043.16760.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig70043:731..976+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig70043:731..976+ >mRNA_M-pyrifera_M_contig70043.16760.1 ID=mRNA_M-pyrifera_M_contig70043.16760.1|Name=mRNA_M-pyrifera_M_contig70043.16760.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=492bp|location=Sequence derived from alignment at M-pyrifera_M_contig70043:731..976+ (Macrocystis pyrifera P11B4 male)back to top |