mRNA_M-pyrifera_M_contig108616.1817.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108616.1817.1 vs. uniprot
Match: E0XR38_9GAMM (Uncharacterized protein n=1 Tax=uncultured gamma proteobacterium HF0010_16J05 TaxID=710981 RepID=E0XR38_9GAMM) HSP 1 Score: 46.6 bits (109), Expect = 1.980e-5 Identity = 20/25 (80.00%), Postives = 21/25 (84.00%), Query Frame = 3 Query: 96 GGIPERPKGPDCKSGGYAFAGSNPA 170 GGIPER KG DCKS GYAF GSNP+ Sbjct: 12 GGIPERSKGSDCKSDGYAFEGSNPS 36
BLAST of mRNA_M-pyrifera_M_contig108616.1817.1 vs. uniprot
Match: A0A0K2AWJ4_STRA7 (Uncharacterized protein n=1 Tax=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) TaxID=278992 RepID=A0A0K2AWJ4_STRA7) HSP 1 Score: 46.2 bits (108), Expect = 4.460e-5 Identity = 19/26 (73.08%), Postives = 21/26 (80.77%), Query Frame = 3 Query: 96 GGIPERPKGPDCKSGGYAFAGSNPAS 173 GG+PERPKG DCKS G AF GSNP + Sbjct: 35 GGVPERPKGADCKSAGSAFPGSNPGA 60
BLAST of mRNA_M-pyrifera_M_contig108616.1817.1 vs. uniprot
Match: A0A1T4ZL23_9CYAN (Uncharacterized protein n=1 Tax=Planktothrix sp. PCC 11201 TaxID=1729650 RepID=A0A1T4ZL23_9CYAN) HSP 1 Score: 45.8 bits (107), Expect = 4.640e-5 Identity = 20/31 (64.52%), Postives = 22/31 (70.97%), Query Frame = 3 Query: 102 IPERPKGPDCKSGGYAFAGSNPASPIQKNWK 194 +PER G DCKS GYA+AGSNPA P K K Sbjct: 1 MPERLMGADCKSAGYAYAGSNPARPTSKTQK 31 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108616.1817.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108616.1817.1 >prot_M-pyrifera_M_contig108616.1817.1 ID=prot_M-pyrifera_M_contig108616.1817.1|Name=mRNA_M-pyrifera_M_contig108616.1817.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=67bp ASVAQSAEHRFCKPKVVGSIPTASSFTSAGWEGEFPSGQRGQTVNLVATPback to top mRNA from alignment at M-pyrifera_M_contig108616:161..423- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108616.1817.1 ID=mRNA_M-pyrifera_M_contig108616.1817.1|Name=mRNA_M-pyrifera_M_contig108616.1817.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=263bp|location=Sequence derived from alignment at M-pyrifera_M_contig108616:161..423- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108616:161..423- >mRNA_M-pyrifera_M_contig108616.1817.1 ID=mRNA_M-pyrifera_M_contig108616.1817.1|Name=mRNA_M-pyrifera_M_contig108616.1817.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=402bp|location=Sequence derived from alignment at M-pyrifera_M_contig108616:161..423- (Macrocystis pyrifera P11B4 male)back to top |