mRNA_M-pyrifera_M_contig108421.1788.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108421.1788.1 vs. uniprot
Match: A0A7R9XV71_MICPS (Sulfotransferase (Fragment) n=1 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7R9XV71_MICPS) HSP 1 Score: 60.8 bits (146), Expect = 1.710e-9 Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 1 Query: 1 IARHLGLEEAYVQEGETLEEG-IDRLLPRMGFEYMKSHLELFSPRSVKWRDPNFTFVRRGVVGGH 192 IA H+ L + G L E +D + + GF+ MK+ ++ F PRSV+WRDP + F+R+GVVG H Sbjct: 136 IADHVLLNASPADRGPRLTEAQLDAIAAKCGFDAMKADVDRFQPRSVRWRDPEYCFIRKGVVGDH 200
BLAST of mRNA_M-pyrifera_M_contig108421.1788.1 vs. uniprot
Match: C1N7H0_MICPC (Sulfotransferase n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1N7H0_MICPC) HSP 1 Score: 60.8 bits (146), Expect = 2.990e-9 Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 1 Query: 1 IARHLGLEEAYVQEGETLEEG-IDRLLPRMGFEYMKSHLELFSPRSVKWRDPNFTFVRRGVVGGH 192 IA H+ L + G L E +D + + GF+ MK+ ++ F PRSV+WRDP + F+R+GVVG H Sbjct: 192 IADHVLLNASPADRGPRLTEAQLDAIAAKCGFDAMKADVDRFQPRSVRWRDPEYCFIRKGVVGDH 256 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108421.1788.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108421.1788.1 >prot_M-pyrifera_M_contig108421.1788.1 ID=prot_M-pyrifera_M_contig108421.1788.1|Name=mRNA_M-pyrifera_M_contig108421.1788.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bp IARHLGLEEAYVQEGETLEEGIDRLLPRMGFEYMKSHLELFSPRSVKWRDback to top mRNA from alignment at M-pyrifera_M_contig108421:403..612- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108421.1788.1 ID=mRNA_M-pyrifera_M_contig108421.1788.1|Name=mRNA_M-pyrifera_M_contig108421.1788.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=210bp|location=Sequence derived from alignment at M-pyrifera_M_contig108421:403..612- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108421:403..612- >mRNA_M-pyrifera_M_contig108421.1788.1 ID=mRNA_M-pyrifera_M_contig108421.1788.1|Name=mRNA_M-pyrifera_M_contig108421.1788.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=420bp|location=Sequence derived from alignment at M-pyrifera_M_contig108421:403..612- (Macrocystis pyrifera P11B4 male)back to top |