mRNA_M-pyrifera_M_contig108208.1751.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108208.1751.1 vs. uniprot
Match: R1D492_EMIHU (Ephrin_rec_like domain-containing protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1D492_EMIHU) HSP 1 Score: 52.4 bits (124), Expect = 4.020e-6 Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 1 Query: 1 NDVWVLDPESWEWAEVQPAGRGPEPRAFHSAVAQGETMLVLGGVGEFAGFPLDVLHILDLSDESAAQWTALR 216 +DVW ++ + EW V+ A P RAFH+A A GE MLV GGV + G L+ L L +S QW LR Sbjct: 366 SDVWEVNAATGEWRAVK-AAVPPRGRAFHTATAVGEAMLVFGGV-DAQGETLNDLWALHVSTVVGTQWAELR 435 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108208.1751.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108208.1751.1 >prot_M-pyrifera_M_contig108208.1751.1 ID=prot_M-pyrifera_M_contig108208.1751.1|Name=mRNA_M-pyrifera_M_contig108208.1751.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=72bp NDVWVLDPESWEWAEVQPAGRGPEPRAFHSAVAQGETMLVLGGVGEFAGFback to top mRNA from alignment at M-pyrifera_M_contig108208:57..272+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108208.1751.1 ID=mRNA_M-pyrifera_M_contig108208.1751.1|Name=mRNA_M-pyrifera_M_contig108208.1751.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=216bp|location=Sequence derived from alignment at M-pyrifera_M_contig108208:57..272+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108208:57..272+ >mRNA_M-pyrifera_M_contig108208.1751.1 ID=mRNA_M-pyrifera_M_contig108208.1751.1|Name=mRNA_M-pyrifera_M_contig108208.1751.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=432bp|location=Sequence derived from alignment at M-pyrifera_M_contig108208:57..272+ (Macrocystis pyrifera P11B4 male)back to top |