mRNA_M-pyrifera_M_contig108195.1744.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig108195.1744.1 vs. uniprot
Match: A0A7C1KIW8_9BACT (Uncharacterized protein n=2 Tax=Gemmataceae TaxID=1914233 RepID=A0A7C1KIW8_9BACT) HSP 1 Score: 48.5 bits (114), Expect = 8.140e-5 Identity = 21/54 (38.89%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 154 MRKWAMLGLAMLCLLPQMLIEFFYAPPFDVTAYASNIDYEFASDEYAFDFAAEN 315 +++W ++G+ ++ L+P L E F+ PPFD+T + +DYEF + A +FAA N Sbjct: 20 LKRWLVIGIVLVFLMPLALWETFFPPPFDITVCSDTVDYEFRDPDCAVEFAALN 73 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig108195.1744.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig108195.1744.1 >prot_M-pyrifera_M_contig108195.1744.1 ID=prot_M-pyrifera_M_contig108195.1744.1|Name=mRNA_M-pyrifera_M_contig108195.1744.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=114bp GRPVVVRVPTCRGCGWRLKWSRLLSFLFTMATVLVAFFLIWPYLDDFVPRback to top mRNA from alignment at M-pyrifera_M_contig108195:273..614- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig108195.1744.1 ID=mRNA_M-pyrifera_M_contig108195.1744.1|Name=mRNA_M-pyrifera_M_contig108195.1744.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=342bp|location=Sequence derived from alignment at M-pyrifera_M_contig108195:273..614- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig108195:273..614- >mRNA_M-pyrifera_M_contig108195.1744.1 ID=mRNA_M-pyrifera_M_contig108195.1744.1|Name=mRNA_M-pyrifera_M_contig108195.1744.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=684bp|location=Sequence derived from alignment at M-pyrifera_M_contig108195:273..614- (Macrocystis pyrifera P11B4 male)back to top |