mRNA_M-pyrifera_M_contig106323.1369.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig106323.1369.1 vs. uniprot
Match: A0A3M2GL60_ACTSX (Uncharacterized protein n=1 Tax=Actinomyces sp. TaxID=29317 RepID=A0A3M2GL60_ACTSX) HSP 1 Score: 92.0 bits (227), Expect = 1.290e-19 Identity = 53/101 (52.48%), Postives = 69/101 (68.32%), Query Frame = 1 Query: 73 LAVVILVPLFGEDFSAGQNALLILFVAAAATTASAPYRVLYTAFAADRVVAVVTVGAAGVNFGANLLVIGRWGIEGAAATTLLTQLGMFVFFAVWSHRARA 375 LAV L P++G +F AG++AL++L VA TT SAP RVL+ F +DR VA+VTV AA N GANLL++G WG+ AAATTL Q+ + +F W RA A Sbjct: 204 LAVWSLGPVWGPEFVAGRDALVLLVVAVGLTTVSAPLRVLHVGFGSDRQVALVTVLAAVGNLGANLLLVGTWGMTAAAATTLAAQVALLAYFVTWGWRAAA 304 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig106323.1369.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig106323.1369.1 >prot_M-pyrifera_M_contig106323.1369.1 ID=prot_M-pyrifera_M_contig106323.1369.1|Name=mRNA_M-pyrifera_M_contig106323.1369.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=138bp MARVHRLADRAALIGGLATIPATGLAVVILVPLFGEDFSAGQNALLILFVback to top mRNA from alignment at M-pyrifera_M_contig106323:26..439+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig106323.1369.1 ID=mRNA_M-pyrifera_M_contig106323.1369.1|Name=mRNA_M-pyrifera_M_contig106323.1369.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=414bp|location=Sequence derived from alignment at M-pyrifera_M_contig106323:26..439+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig106323:26..439+ >mRNA_M-pyrifera_M_contig106323.1369.1 ID=mRNA_M-pyrifera_M_contig106323.1369.1|Name=mRNA_M-pyrifera_M_contig106323.1369.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=828bp|location=Sequence derived from alignment at M-pyrifera_M_contig106323:26..439+ (Macrocystis pyrifera P11B4 male)back to top |