mRNA_M-pyrifera_M_contig10629.1356.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: A0A6H5KKN7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKN7_9PHAE) HSP 1 Score: 122 bits (307), Expect = 7.390e-31 Identity = 52/65 (80.00%), Postives = 57/65 (87.69%), Query Frame = 1 Query: 1 PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKYWCEQ 195 P Q IL DYLPGNPYS+LIQPVWCSY +GAR VTVVSPDGK+FFQRGWFHSEH AID+YWC+Q Sbjct: 322 PSQDILVDYLPGNPYSELIQPVWCSYSMGARPVTVVSPDGKLFFQRGWFHSEHVGRAIDEYWCQQ 386
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: D8LCJ3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCJ3_ECTSI) HSP 1 Score: 120 bits (301), Expect = 2.530e-30 Identity = 51/65 (78.46%), Postives = 56/65 (86.15%), Query Frame = 1 Query: 1 PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKYWCEQ 195 P Q IL DYLPGNPYS+LIQPVWCSY +GAR VTVVSPDGK+FFQR WFHSEH AID+YWC+Q Sbjct: 292 PSQDILVDYLPGNPYSELIQPVWCSYSMGARPVTVVSPDGKLFFQRAWFHSEHVGRAIDEYWCQQ 356
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: A0A6H5L0M4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0M4_9PHAE) HSP 1 Score: 81.6 bits (200), Expect = 1.830e-16 Identity = 33/61 (54.10%), Postives = 44/61 (72.13%), Query Frame = 1 Query: 1 PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKY 183 P+Q I+ DY+PGNPYSDLI P+WCSY IGAR T ++ DG IF+Q+ W H+ A +D + Sbjct: 201 PEQAIIPDYMPGNPYSDLINPLWCSYGIGARPATAIAQDGTIFYQQEWLHTGDLANELDVF 261
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: D7FZ87_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZ87_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 1.400e-15 Identity = 29/59 (49.15%), Postives = 42/59 (71.19%), Query Frame = 1 Query: 7 QTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKY 183 Q ++ DY+PGNPYS+LI P+WCSY +GAR T ++ DG IF+Q+ W H+ A +D + Sbjct: 3 QALIPDYMPGNPYSELINPLWCSYGLGARPATAIAQDGTIFYQQEWLHTGDLADELDVF 61
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: D8LC80_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LC80_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 2.190e-14 Identity = 32/62 (51.61%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 1 PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKYW 186 P + +L DYL GNPYS L QPVWC+Y GAR +VS G +F+Q+ W +E AID YW Sbjct: 166 PDEVVLPDYLTGNPYSSLNQPVWCTYANGARPSVMVSSSGSVFYQQEWLSTEGLGNAIDGYW 227
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Match: A0A6H5JSG9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSG9_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 2.890e-14 Identity = 33/62 (53.23%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 1 PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHSEHTALAIDKYW 186 P + +L DYL GNPYS L QPVWC+Y GAR +VS G IF+Q+ W +E AID YW Sbjct: 191 PDEVVLPDYLTGNPYSSLNQPVWCTYANGARPSVMVSSSGSIFYQQEWMSTEGLENAIDGYW 252 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10629.1356.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig10629.1356.1 >prot_M-pyrifera_M_contig10629.1356.1 ID=prot_M-pyrifera_M_contig10629.1356.1|Name=mRNA_M-pyrifera_M_contig10629.1356.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=93bp PQQTILTDYLPGNPYSDLIQPVWCSYLIGARGVTVVSPDGKIFFQRGWFHback to top mRNA from alignment at M-pyrifera_M_contig10629:165..443+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig10629.1356.1 ID=mRNA_M-pyrifera_M_contig10629.1356.1|Name=mRNA_M-pyrifera_M_contig10629.1356.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=279bp|location=Sequence derived from alignment at M-pyrifera_M_contig10629:165..443+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig10629:165..443+ >mRNA_M-pyrifera_M_contig10629.1356.1 ID=mRNA_M-pyrifera_M_contig10629.1356.1|Name=mRNA_M-pyrifera_M_contig10629.1356.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=558bp|location=Sequence derived from alignment at M-pyrifera_M_contig10629:165..443+ (Macrocystis pyrifera P11B4 male)back to top |