mRNA_M-pyrifera_M_contig106034.1304.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig106034.1304.1 vs. uniprot
Match: A0A388PM67_9BACT (Uncharacterized protein YbeQ n=1 Tax=Opitutae bacterium TaxID=2026771 RepID=A0A388PM67_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 6.940e-6 Identity = 31/65 (47.69%), Postives = 38/65 (58.46%), Query Frame = 1 Query: 31 WKELLARAEAGDAEAQYNAGGRLLGGKFGAPLDLEAAERWFDRAADAGHAMGTLLAGMC--KGAF 219 W L+A+AEAGDAEAQ++ +L G F P + A RWF RAAD GH + G C KG F Sbjct: 64 WPALVAKAEAGDAEAQFHRAMGMLTGLF-EPANPAQARRWFLRAADQGHGRALIALGECESKGEF 127
BLAST of mRNA_M-pyrifera_M_contig106034.1304.1 vs. uniprot
Match: A0A2M8UFG3_9PROT (Uncharacterized protein n=1 Tax=Ferrovibrio sp. TaxID=1917215 RepID=A0A2M8UFG3_9PROT) HSP 1 Score: 53.1 bits (126), Expect = 7.610e-6 Identity = 42/95 (44.21%), Postives = 50/95 (52.63%), Query Frame = 1 Query: 40 LLARAEAGDAEAQYNAGGRLLGGKFGAPLDLEAAERWFDRAADAGH--AMGTLLAGMCKGAFAMGRPPDAQEFWRLVLRAAELGVAEGAEWLRVA 318 LL RAEAG+AEAQY G + G P D AA WF +AA H A+G+L + GA G PPDA R + RA ELG E W +A Sbjct: 53 LLRRAEAGNAEAQYQVG-VIHQFSLGVPRDDAAARGWFAKAAAQDHPRALGSLGYMLIAGA---GGPPDAAGAERALRRAGELG--EATAWANLA 141 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig106034.1304.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig106034.1304.1 >prot_M-pyrifera_M_contig106034.1304.1 ID=prot_M-pyrifera_M_contig106034.1304.1|Name=mRNA_M-pyrifera_M_contig106034.1304.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=107bp HASPEHTREPWKELLARAEAGDAEAQYNAGGRLLGGKFGAPLDLEAAERWback to top mRNA from alignment at M-pyrifera_M_contig106034:107..427+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig106034.1304.1 ID=mRNA_M-pyrifera_M_contig106034.1304.1|Name=mRNA_M-pyrifera_M_contig106034.1304.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=321bp|location=Sequence derived from alignment at M-pyrifera_M_contig106034:107..427+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig106034:107..427+ >mRNA_M-pyrifera_M_contig106034.1304.1 ID=mRNA_M-pyrifera_M_contig106034.1304.1|Name=mRNA_M-pyrifera_M_contig106034.1304.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=642bp|location=Sequence derived from alignment at M-pyrifera_M_contig106034:107..427+ (Macrocystis pyrifera P11B4 male)back to top |