mRNA_M-pyrifera_M_contig104995.1078.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104995.1078.1 vs. uniprot
Match: UPI00192D5BEF (hypothetical protein n=1 Tax=Fulvivirga marina TaxID=2494733 RepID=UPI00192D5BEF) HSP 1 Score: 55.1 bits (131), Expect = 3.360e-6 Identity = 29/65 (44.62%), Postives = 38/65 (58.46%), Query Frame = 1 Query: 4 KWIDDLPAGLKADIGDANSKLGKFLANVSEARRAELIDAWKVL--SDKGLDVLARNPEAL--KYL 186 KW D+LP LKADIG+ S L S+ARRAEL++AW V+ KG+ + N + KYL Sbjct: 1006 KWFDELPEALKADIGEQGSDLWHLFEKASDARRAELVEAWDVVIKPSKGVREITGNLNTIREKYL 1070
BLAST of mRNA_M-pyrifera_M_contig104995.1078.1 vs. uniprot
Match: UPI001BE8DC56 (hypothetical protein n=1 Tax=Exiguobacterium algae TaxID=2751250 RepID=UPI001BE8DC56) HSP 1 Score: 49.7 bits (117), Expect = 5.440e-5 Identity = 29/61 (47.54%), Postives = 36/61 (59.02%), Query Frame = 1 Query: 202 GAKFGDDGVESFTGIKSIWDKKFPSTVNSDGTSKLVRHHAIEQKVLNKYPNLITKKEMHSI 384 GAK GV + + + +P T K+V HHAIEQ+VL +YPNLITK EMHSI Sbjct: 24 GAKGASKGVSDY---RETFFTHYPET-----RGKVVVHHAIEQQVLKRYPNLITKAEMHSI 76 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104995.1078.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104995.1078.1 >prot_M-pyrifera_M_contig104995.1078.1 ID=prot_M-pyrifera_M_contig104995.1078.1|Name=mRNA_M-pyrifera_M_contig104995.1078.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=128bp GKWIDDLPAGLKADIGDANSKLGKFLANVSEARRAELIDAWKVLSDKGLDback to top mRNA from alignment at M-pyrifera_M_contig104995:4..387- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104995.1078.1 ID=mRNA_M-pyrifera_M_contig104995.1078.1|Name=mRNA_M-pyrifera_M_contig104995.1078.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=384bp|location=Sequence derived from alignment at M-pyrifera_M_contig104995:4..387- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104995:4..387- >mRNA_M-pyrifera_M_contig104995.1078.1 ID=mRNA_M-pyrifera_M_contig104995.1078.1|Name=mRNA_M-pyrifera_M_contig104995.1078.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=768bp|location=Sequence derived from alignment at M-pyrifera_M_contig104995:4..387- (Macrocystis pyrifera P11B4 male)back to top |