mRNA_M-pyrifera_M_contig104926.1052.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: A0A838T898_9BACT (T9SS type A sorting domain-containing protein n=1 Tax=Chitinophagales bacterium TaxID=2448779 RepID=A0A838T898_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 5.920e-6 Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1 Query: 421 FYTMINNGDGTFGSPLATNTFD--GPSAVDAGDLDNDGDVDLVLSS--------NTDYNIYVYKNNGDGTF 603 F+T INNGDGTFG P T + + G S +DA D+DNDGD+D VL+ N+ I++ KNNG GTF Sbjct: 497 FHTAINNGDGTFG-PRQTWSMNACGWSDIDAFDMDNDGDLDAVLTEWLGCTNDPNSARRIFISKNNGSGTF 566
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: A0A820Q676_9BILA (Hypothetical protein (Fragment) n=1 Tax=Adineta steineri TaxID=433720 RepID=A0A820Q676_9BILA) HSP 1 Score: 52.8 bits (125), Expect = 1.750e-5 Identity = 27/77 (35.06%), Postives = 44/77 (57.14%), Query Frame = 1 Query: 397 VAIDEYSKFYTMINNGDGTF--GSPLATNTFDGPSAVDAGDLDNDGDVDLVLSSNTDYNIYVYKNNGDGTFSNHQGY 621 + +D S + G+GTF GS +T + P ++ GDL+ND +D+V+++ N+ V+ GDGTFSN + Y Sbjct: 44 ITVDYSSNILIFLGYGNGTFVKGSTYSTGSGSRPLSITVGDLNNDNQLDIVVTNCLTDNVVVFSGEGDGTFSNQRTY 120
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: UPI00082D0A19 (T9SS type A sorting domain-containing protein n=1 Tax=Tamlana agarivorans TaxID=481183 RepID=UPI00082D0A19) HSP 1 Score: 55.5 bits (132), Expect = 1.940e-5 Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 403 IDEYSKFYTMINNGDGTFG--SPLATNTFDG-PSAVDAGDLDNDGDVDLVLSSNTDYNIYVYKNNGDGTFSN 609 ID +K + NNGD TFG S NT+ P+ AGD+D DGD+D+++SS IY+ KN+G G F+N Sbjct: 510 IDRINKIAWIKNNGDLTFGDLSVFTDNTYGFIPNKYTAGDIDRDGDIDIIVSSKNYSRIYLLKNDGLGNFTN 581
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: A0A356KWZ5_9BACT (Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A356KWZ5_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 3.480e-5 Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 412 YSKFYTMINNGDGTFGSPLATNTFDGPSAVDAGDLDNDGDVDLVLSSNTDYNIYVYKNNGDGTFSNH 612 + K Y +N+G G FGS + + F G D GDLD DGD DLVL+ ++ + YV N+G GT ++H Sbjct: 549 FKKLYVSLNDGTGVFGSFVGIHNF-GHLFADQGDLDGDGDTDLVLAGSSSF--YVLMNDGGGTLTHH 612
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: U5QK37_9CYAN (Uncharacterized protein n=1 Tax=Gloeobacter kilaueensis JS1 TaxID=1183438 RepID=U5QK37_9CYAN) HSP 1 Score: 53.9 bits (128), Expect = 6.320e-5 Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 397 VAIDEYSKFYTMINNGDGTFGSPLATNTFDGPSAVDAGDLDNDGDVDLVLS 549 V + S ++N GDGTF +P +T DG S++ AGDLD DGDVDLV S Sbjct: 637 VTVSNGSIVSVLLNRGDGTFDAPAIFHTIDGNSSISAGDLDGDGDVDLVTS 687
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Match: A0A1G1TID1_9BACT (Uncharacterized protein n=1 Tax=Hymenobacter coccineus TaxID=1908235 RepID=A0A1G1TID1_9BACT) HSP 1 Score: 53.9 bits (128), Expect = 6.900e-5 Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 1 Query: 433 INNGDGTFGSPLATNTFDGPSAVDAGDLDNDGDVDLVLSS---NTDYNIYVYKNNGDGTFSNHQGYENLG 633 +N+G GTFGSP A P+++ GD+DNDGD+DLV+ + NT + V N+G+GTF + Q Y G Sbjct: 187 LNDGRGTFGSPRAVEVGISPTSLALGDMDNDGDLDLVVGAGIQNTSA-LNVALNDGEGTFGSPQSYSIFG 255 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104926.1052.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104926.1052.1 >prot_M-pyrifera_M_contig104926.1052.1 ID=prot_M-pyrifera_M_contig104926.1052.1|Name=mRNA_M-pyrifera_M_contig104926.1052.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=213bp DSDSTYATKVNLSVGDSPTNFTIADLDGDGDEDMIMSDNDSYYVKVLYNDback to top mRNA from alignment at M-pyrifera_M_contig104926:2..640+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104926.1052.1 ID=mRNA_M-pyrifera_M_contig104926.1052.1|Name=mRNA_M-pyrifera_M_contig104926.1052.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=639bp|location=Sequence derived from alignment at M-pyrifera_M_contig104926:2..640+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104926:2..640+ >mRNA_M-pyrifera_M_contig104926.1052.1 ID=mRNA_M-pyrifera_M_contig104926.1052.1|Name=mRNA_M-pyrifera_M_contig104926.1052.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1278bp|location=Sequence derived from alignment at M-pyrifera_M_contig104926:2..640+ (Macrocystis pyrifera P11B4 male)back to top |