mRNA_M-pyrifera_M_contig104813.1025.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104813.1025.1 vs. uniprot
Match: A0A7S1Y9T4_9STRA (Hypothetical protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1Y9T4_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 1.140e-7 Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 1 Query: 121 VLYPGSHRHLTAAVAFDSVLFVDCDKRVAETFASAESRSFVE--ELRGAPGNWRFECANYEGPIPGAEDAGHDVLLS 345 V YPG HRHLTAA+AF V FVD DK+V+ + +R +V+ +L +RF C + P +D+L+S Sbjct: 8 VFYPGCHRHLTAALAFPDVTFVDFDKKVSPLYDDPTAREYVDTYKLYDEASQYRFYCYDVHKQPPKKARQDYDLLVS 84
BLAST of mRNA_M-pyrifera_M_contig104813.1025.1 vs. uniprot
Match: A0A3M7PZ70_BRAPC (Uncharacterized protein n=1 Tax=Brachionus plicatilis TaxID=10195 RepID=A0A3M7PZ70_BRAPC) HSP 1 Score: 52.4 bits (124), Expect = 1.490e-5 Identity = 24/65 (36.92%), Postives = 41/65 (63.08%), Query Frame = 1 Query: 52 DWHLPLFRAVADWANARQGAPLQVLYPGSHRHLTAAVAFDSVLFVDCDKRVAETFASAESRSFVE 246 DWHLP+FRAV ++ A++ VLYPGS++H++ ++ +V + D D ++ + F E +VE Sbjct: 16 DWHLPIFRAVQEFTEAKR-----VLYPGSYKHISPSLFLPNVTYNDFDIKMKQFFDDEEVLKWVE 75 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104813.1025.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104813.1025.1 >prot_M-pyrifera_M_contig104813.1025.1 ID=prot_M-pyrifera_M_contig104813.1025.1|Name=mRNA_M-pyrifera_M_contig104813.1025.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bp MAGLRAYKRSYWGGGPADWHLPLFRAVADWANARQGAPLQVLYPGSHRHLback to top mRNA from alignment at M-pyrifera_M_contig104813:1..345- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104813.1025.1 ID=mRNA_M-pyrifera_M_contig104813.1025.1|Name=mRNA_M-pyrifera_M_contig104813.1025.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=345bp|location=Sequence derived from alignment at M-pyrifera_M_contig104813:1..345- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104813:1..345- >mRNA_M-pyrifera_M_contig104813.1025.1 ID=mRNA_M-pyrifera_M_contig104813.1025.1|Name=mRNA_M-pyrifera_M_contig104813.1025.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=690bp|location=Sequence derived from alignment at M-pyrifera_M_contig104813:1..345- (Macrocystis pyrifera P11B4 male)back to top |