mRNA_M-pyrifera_M_contig102422.512.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig102422.512.1 vs. uniprot
Match: A0A3D0N141_9BACT (Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A3D0N141_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 1.160e-6 Identity = 28/69 (40.58%), Postives = 41/69 (59.42%), Query Frame = 1 Query: 58 YAQTSLVPAHHSVYDYLFYQRAVGNIPFYNHEDLPISRGEIVDYLKEIEVSGSLSFSDMETIKAYLVEF 264 Y+Q L P VY +L + G IP YN LP+SR ++ +YL +I S S+S SD E +K YL+++ Sbjct: 21 YSQQELTPVSDDVYFFLKRMQVAGVIPDYNSSLLPLSRKQVANYLNQINNSSSVSSSDREVLKGYLLDY 89 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig102422.512.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig102422.512.1 >prot_M-pyrifera_M_contig102422.512.1 ID=prot_M-pyrifera_M_contig102422.512.1|Name=mRNA_M-pyrifera_M_contig102422.512.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=122bp MLPVLVAFFLSTKYSYAQTSLVPAHHSVYDYLFYQRAVGNIPFYNHEDLPback to top mRNA from alignment at M-pyrifera_M_contig102422:156..533+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig102422.512.1 ID=mRNA_M-pyrifera_M_contig102422.512.1|Name=mRNA_M-pyrifera_M_contig102422.512.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=378bp|location=Sequence derived from alignment at M-pyrifera_M_contig102422:156..533+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig102422:156..533+ >mRNA_M-pyrifera_M_contig102422.512.1 ID=mRNA_M-pyrifera_M_contig102422.512.1|Name=mRNA_M-pyrifera_M_contig102422.512.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=732bp|location=Sequence derived from alignment at M-pyrifera_M_contig102422:156..533+ (Macrocystis pyrifera P11B4 male)back to top |