mRNA_M-pyrifera_M_contig102289.486.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: D8LIX8_ECTSI (Putative Glutathione S-transferase putative Glutathione S-transferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LIX8_ECTSI) HSP 1 Score: 78.2 bits (191), Expect = 4.860e-16 Identity = 33/36 (91.67%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPRVTLYRDHA WCPYCEKVWL LEEKRIPYRV+KV Sbjct: 143 EPRVTLYRDHAGWCPYCEKVWLLLEEKRIPYRVKKV 178
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: C1FEW2_MICCC (Glutathione s-transferase n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1FEW2_MICCC) HSP 1 Score: 78.6 bits (192), Expect = 6.150e-16 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPRV YRDHAAWCPYCEK+W+QLEEKRIPYRVEK+ Sbjct: 120 EPRVLFYRDHAAWCPYCEKIWMQLEEKRIPYRVEKI 155
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A6U2EXV2_HEMAN (Hypothetical protein n=1 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A6U2EXV2_HEMAN) HSP 1 Score: 78.6 bits (192), Expect = 6.150e-16 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPRVTLYRD AAWCPYCEKVWLQLEEKRIPY+VEKV Sbjct: 150 EPRVTLYRDVAAWCPYCEKVWLQLEEKRIPYKVEKV 185
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A7S0I190_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Hanusia phi TaxID=3032 RepID=A0A7S0I190_9CRYP) HSP 1 Score: 75.9 bits (185), Expect = 1.110e-15 Identity = 32/36 (88.89%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPRV LYRD AAWCPYCEKVWL LEEKR+PYRVEKV Sbjct: 47 EPRVILYRDKAAWCPYCEKVWLHLEEKRVPYRVEKV 82
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: F0XZY4_AURAN (GST N-terminal domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0XZY4_AURAN) HSP 1 Score: 75.9 bits (185), Expect = 1.330e-15 Identity = 32/44 (72.73%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 1 LYAEP---EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 L+ EP EPRVTLYRD ++WCPYC+KVW+QLEEKRIPYRVE++ Sbjct: 84 LFDEPDGYEPRVTLYRDGSSWCPYCQKVWMQLEEKRIPYRVERI 127
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A1C0UTA8_9CYAN (Glutathione S-transferase n=5 Tax=Limnothrix TaxID=132605 RepID=A0A1C0UTA8_9CYAN) HSP 1 Score: 77.4 bits (189), Expect = 1.340e-15 Identity = 33/43 (76.74%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 1 LYAEP--EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 L+ +P EPRVTLYRDH AWCPYC+KVWL LEEK+IPYR+EKV Sbjct: 34 LFGQPDAEPRVTLYRDHHAWCPYCQKVWLWLEEKQIPYRIEKV 76
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A061QI63_9CHLO (Glutathione S-transferase n=4 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061QI63_9CHLO) HSP 1 Score: 77.4 bits (189), Expect = 1.540e-15 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EP V LYRDHAAWCPYC+K+WLQLEEKRIPYRVEK+ Sbjct: 71 EPDVVLYRDHAAWCPYCQKIWLQLEEKRIPYRVEKI 106
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A7S0I7Z3_MICPS (Hypothetical protein n=1 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0I7Z3_MICPS) HSP 1 Score: 77.0 bits (188), Expect = 2.130e-15 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPRV +RDHAAWCPYCEK+W+QLEEKRIPYRVEK+ Sbjct: 75 EPRVLFFRDHAAWCPYCEKIWMQLEEKRIPYRVEKI 110
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A6N2JTN2_9CYAN (Glutathione S-transferase family protein n=4 Tax=unclassified Pseudanabaena TaxID=2593292 RepID=A0A6N2JTN2_9CYAN) HSP 1 Score: 76.6 bits (187), Expect = 2.560e-15 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 4 YAEPEPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 YAE + RVTLYRDH AWCPYC+K+WL LEEK+IPYR+EKV Sbjct: 37 YAEADVRVTLYRDHHAWCPYCQKIWLWLEEKQIPYRIEKV 76
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Match: A0A7S2HEV5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2HEV5_9STRA) HSP 1 Score: 74.3 bits (181), Expect = 2.640e-15 Identity = 30/36 (83.33%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 16 EPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKV 123 EPR+ +RDHAAWCPYC KVWL LEEKRIPYRVEKV Sbjct: 130 EPRIVFFRDHAAWCPYCHKVWLALEEKRIPYRVEKV 165 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig102289.486.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig102289.486.1 >prot_M-pyrifera_M_contig102289.486.1 ID=prot_M-pyrifera_M_contig102289.486.1|Name=mRNA_M-pyrifera_M_contig102289.486.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=41bp LYAEPEPRVTLYRDHAAWCPYCEKVWLQLEEKRIPYRVEKVback to top mRNA from alignment at M-pyrifera_M_contig102289:135..257+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig102289.486.1 ID=mRNA_M-pyrifera_M_contig102289.486.1|Name=mRNA_M-pyrifera_M_contig102289.486.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=123bp|location=Sequence derived from alignment at M-pyrifera_M_contig102289:135..257+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig102289:135..257+ >mRNA_M-pyrifera_M_contig102289.486.1 ID=mRNA_M-pyrifera_M_contig102289.486.1|Name=mRNA_M-pyrifera_M_contig102289.486.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig102289:135..257+ (Macrocystis pyrifera P11B4 male)back to top |