mRNA_M-pyrifera_M_contig10221.473.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10221.473.1 vs. uniprot
Match: D7FR13_ECTSI (EsV-1-7 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FR13_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 3.430e-12 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 1 GCQSHPNFGVEGDRRAIYCAKHKLKDMVNVKAP 99 GCQSHPNFG+EGDRRA+YCAKHKL MVNVKAP Sbjct: 864 GCQSHPNFGIEGDRRAVYCAKHKLPGMVNVKAP 896 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10221.473.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig10221.473.1 >prot_M-pyrifera_M_contig10221.473.1 ID=prot_M-pyrifera_M_contig10221.473.1|Name=mRNA_M-pyrifera_M_contig10221.473.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bp GCQSHPNFGVEGDRRAIYCAKHKLKDMVNVKAPRCREPGCTRNPVYGHAGback to top mRNA from alignment at M-pyrifera_M_contig10221:9693..10037- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig10221.473.1 ID=mRNA_M-pyrifera_M_contig10221.473.1|Name=mRNA_M-pyrifera_M_contig10221.473.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=345bp|location=Sequence derived from alignment at M-pyrifera_M_contig10221:9693..10037- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig10221:9693..10037- >mRNA_M-pyrifera_M_contig10221.473.1 ID=mRNA_M-pyrifera_M_contig10221.473.1|Name=mRNA_M-pyrifera_M_contig10221.473.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=690bp|location=Sequence derived from alignment at M-pyrifera_M_contig10221:9693..10037- (Macrocystis pyrifera P11B4 male)back to top |