prot_L-elsbetiae_contig1718.4777.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1718.4777.1 vs. uniprot
Match: D8LPX1_ECTSI (Alpha/beta hydrolase fold n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LPX1_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 3.120e-9 Identity = 28/35 (80.00%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 6 KTLTKLGNRAREPGIMGRAVTCVPFDAVSCQQRVD 40 K L +LG+RAR+ GIMG AVTCVPFDAVSCQQRVD Sbjct: 279 KFLGELGDRARDMGIMGGAVTCVPFDAVSCQQRVD 313
BLAST of mRNA_L-elsbetiae_contig1718.4777.1 vs. uniprot
Match: A0A835ZB94_9STRA (Alpha/beta hydrolase protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZB94_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.070e-5 Identity = 20/35 (57.14%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 6 KTLTKLGNRAREPGIMGRAVTCVPFDAVSCQQRVD 40 K L ++G+RA+E GI+G +V+CVPFDAV CQ+++D Sbjct: 194 KYLGEIGSRAQELGIIGASVSCVPFDAVGCQEQID 228 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1718.4777.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1718.4777.1 ID=prot_L-elsbetiae_contig1718.4777.1|Name=mRNA_L-elsbetiae_contig1718.4777.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bpback to top |