mRNA_L-elsbetiae_contig14599.3352.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14599.3352.1 vs. uniprot
Match: D7G9A2_ECTSI (Cellulose synthase (UDP-forming), family GT2 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9A2_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 2.240e-7 Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 3 Query: 24 IIGGSVWRMLAFPWYHFVPAIVLAVGNFCLNISSIIH 134 I GG VWRM WYHFVPA+V AVG F LN+S++++ Sbjct: 1128 IFGGCVWRMTMLTWYHFVPAMVFAVGTFALNMSTLVY 1164
BLAST of mRNA_L-elsbetiae_contig14599.3352.1 vs. uniprot
Match: A0A6H5K7X7_9PHAE (GT2 protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K7X7_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 5.720e-7 Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 3 Query: 24 IIGGSVWRMLAFPWYHFVPAIVLAVGNFCLNISSIIH 134 I GG WRM WYHFVPA+V AVG F LN+S++I+ Sbjct: 1230 IFGGCAWRMTMLTWYHFVPAMVFAVGTFALNMSTLIY 1266
BLAST of mRNA_L-elsbetiae_contig14599.3352.1 vs. uniprot
Match: D7FP53_ECTSI (Cellulose synthase (UDP-forming), family GT2 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP53_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 2.690e-6 Identity = 21/43 (48.84%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 3 TTAVTVGIIGGSVWRMLAFPWYHFVPAIVLAVGNFCLNISSII 131 T T+ +GG+ WR+ FPWYHFVP I+L++ NF L+IS+++ Sbjct: 1173 TMMYTLLTVGGAAWRVTDFPWYHFVPTILLSILNFGLHISTLL 1215 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14599.3352.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14599.3352.1 >prot_L-elsbetiae_contig14599.3352.1 ID=prot_L-elsbetiae_contig14599.3352.1|Name=mRNA_L-elsbetiae_contig14599.3352.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=66bp MEDAGIPLVPLRPRDRPGGWKLLPQYQQHHSLMICTLGNRREPREASKQNback to top mRNA from alignment at L-elsbetiae_contig14599:2016..3241+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14599.3352.1 ID=mRNA_L-elsbetiae_contig14599.3352.1|Name=mRNA_L-elsbetiae_contig14599.3352.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1226bp|location=Sequence derived from alignment at L-elsbetiae_contig14599:2016..3241+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14599:2016..3241+ >mRNA_L-elsbetiae_contig14599.3352.1 ID=mRNA_L-elsbetiae_contig14599.3352.1|Name=mRNA_L-elsbetiae_contig14599.3352.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=396bp|location=Sequence derived from alignment at L-elsbetiae_contig14599:2016..3241+ (Laminarionema elsbetiae ELsaHSoW15)back to top |