prot_L-elsbetiae_contig13760.2851.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13760.2851.1 vs. uniprot
Match: A0A6H5KWB1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWB1_9PHAE) HSP 1 Score: 75.9 bits (185), Expect = 3.630e-14 Identity = 38/68 (55.88%), Postives = 48/68 (70.59%), Query Frame = 0 Query: 18 AISPSCQTLCASLELACNCLMTSSRAGXXXXXXXXXASYGKGEAWLKSVFALLEAEGQPESEGKTSQG 85 A+SP+C TLCAS++LACNCLM RA + G GEAWL++VFALL+A+GQPESEG+ G Sbjct: 826 AVSPACLTLCASIKLACNCLMAPGRA-----TDVSGGAEGTGEAWLRTVFALLKADGQPESEGEREMG 888
BLAST of mRNA_L-elsbetiae_contig13760.2851.1 vs. uniprot
Match: D7FVV7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVV7_ECTSI) HSP 1 Score: 72.4 bits (176), Expect = 6.010e-13 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 0 Query: 18 AISPSCQTLCASLELACNCLMTSSRAGXXXXXXXXXASYGKGEAWLKSVFALLEAEGQPESEGKTSQG 85 A+SP+C TLCAS++LACNCLM RA + +GEAWL +VFALL+A+GQPES+G+ G Sbjct: 964 AVSPACLTLCASIKLACNCLMAPGRA-----TDVSGGAEDRGEAWLSTVFALLKADGQPESDGEREMG 1026 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13760.2851.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13760.2851.1 ID=prot_L-elsbetiae_contig13760.2851.1|Name=mRNA_L-elsbetiae_contig13760.2851.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=85bpback to top |