prot_L-elsbetiae_contig13085.2435.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13085.2435.1 vs. uniprot
Match: A0A6H5JU58_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JU58_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 4.330e-19 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 0 Query: 1 LSLSHNLVRRTEELLPLASLPLLEALSLEGSPVCGAANYRAHVVSLAPPCLRMLDRREV 59 LS+SHNLVRRTE+L PL+ L LE LSLEG+PVCGAANYRAHVVSLA CL+ LD REV Sbjct: 125 LSISHNLVRRTEDLHPLSLLAHLETLSLEGNPVCGAANYRAHVVSLASACLKTLDGREV 183
BLAST of mRNA_L-elsbetiae_contig13085.2435.1 vs. uniprot
Match: D8LLH8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLH8_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 1.500e-18 Identity = 44/59 (74.58%), Postives = 50/59 (84.75%), Query Frame = 0 Query: 1 LSLSHNLVRRTEELLPLASLPLLEALSLEGSPVCGAANYRAHVVSLAPPCLRMLDRREV 59 LS+SHNLVRRTE+L PL+ L LE LSLEG+PVCGAANYRAHVVSLA CL+ LD RE+ Sbjct: 131 LSISHNLVRRTEDLHPLSLLAHLEMLSLEGNPVCGAANYRAHVVSLASACLKTLDGREM 189 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13085.2435.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13085.2435.1 ID=prot_L-elsbetiae_contig13085.2435.1|Name=mRNA_L-elsbetiae_contig13085.2435.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|