prot_L-elsbetiae_contig6786.15539.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6786.15539.1 vs. uniprot
Match: A0A6H5L556_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L556_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 5.330e-7 Identity = 35/54 (64.81%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 1 MLKAHKRKTRRISGGGGVGRSVSPRPSLL----RGQQEPGRRASST-PSSPIVA 49 MLKAHKRKTRRIS GGG RSVSPRPS R PGRR S T P+SP+ A Sbjct: 1 MLKAHKRKTRRISSGGGSARSVSPRPSFGAEPGRRSAAPGRRKSKTAPTSPLDA 54 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6786.15539.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6786.15539.1 ID=prot_L-elsbetiae_contig6786.15539.1|Name=mRNA_L-elsbetiae_contig6786.15539.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=54bpback to top |