prot_L-elsbetiae_contig20153.6062.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: D7FVU9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVU9_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 2.520e-14 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 26 YVDEHPGWVKIDHPEGYWMPVQQHGHDVMHEV 57 YV EHPGWVKIDHPEGYWMPV+QHG VMHEV Sbjct: 49 YVTEHPGWVKIDHPEGYWMPVEQHGKAVMHEV 80
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A835ZIY5_9STRA (Uncharacterized protein n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZIY5_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 3.320e-12 Identity = 24/31 (77.42%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 26 YVDEHPGWVKIDHPEGYWMPVQQHGHDVMHE 56 YV EHPGWV+IDHP GYWMPV+Q GH V+HE Sbjct: 49 YVQEHPGWVRIDHPNGYWMPVEQDGHTVLHE 79
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A8J4FZJ0_9CHLO (Uncharacterized protein n=1 Tax=Volvox reticuliferus TaxID=1737510 RepID=A0A8J4FZJ0_9CHLO) HSP 1 Score: 58.9 bits (141), Expect = 9.920e-10 Identity = 20/27 (74.07%), Postives = 26/27 (96.30%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DHP+GYW+P+QQ+G+DV H Sbjct: 87 EHPGWVKVDHPKGYWLPIQQYGNDVCH 113
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A8J4G156_9CHLO (Uncharacterized protein n=1 Tax=Volvox reticuliferus TaxID=1737510 RepID=A0A8J4G156_9CHLO) HSP 1 Score: 58.9 bits (141), Expect = 1.110e-9 Identity = 20/27 (74.07%), Postives = 26/27 (96.30%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DHP+GYW+P+QQ+G+DV H Sbjct: 92 EHPGWVKVDHPKGYWLPIQQYGNDVCH 118
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A250X2J7_9CHLO (Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250X2J7_9CHLO) HSP 1 Score: 57.0 bits (136), Expect = 4.410e-9 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 31 PGWVKIDHPEGYWMPVQQHGHDVMHEVK 58 PGWVKIDHP GYWMP+ Q+GHDV+H K Sbjct: 77 PGWVKIDHPNGYWMPISQNGHDVIHFKK 104
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A150GII6_GONPE (Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GII6_GONPE) HSP 1 Score: 57.0 bits (136), Expect = 5.270e-9 Identity = 19/27 (70.37%), Postives = 25/27 (92.59%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DHP+ YW+P+QQ+G+DV H Sbjct: 84 EHPGWVKVDHPQNYWLPIQQYGNDVCH 110
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A7S0S545_9CHLO (Hypothetical protein n=1 Tax=Chlamydomonas leiostraca TaxID=1034604 RepID=A0A7S0S545_9CHLO) HSP 1 Score: 55.8 bits (133), Expect = 1.770e-8 Identity = 18/26 (69.23%), Postives = 24/26 (92.31%), Query Frame = 0 Query: 30 HPGWVKIDHPEGYWMPVQQHGHDVMH 55 HPGWVK+DHP+GYW+P++QHG V+H Sbjct: 94 HPGWVKVDHPQGYWLPIEQHGKPVVH 119
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A835TBT2_CHLIN (Uncharacterized protein n=1 Tax=Chlamydomonas incerta TaxID=51695 RepID=A0A835TBT2_CHLIN) HSP 1 Score: 54.7 bits (130), Expect = 2.470e-8 Identity = 19/27 (70.37%), Postives = 23/27 (85.19%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DH +GYWMP++QHG V H Sbjct: 58 EHPGWVKVDHEKGYWMPIEQHGKPVCH 84
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A8J4I5_CHLRE (Predicted protein n=3 Tax=Chlamydomonas TaxID=3052 RepID=A8J4I5_CHLRE) HSP 1 Score: 54.7 bits (130), Expect = 4.230e-8 Identity = 19/27 (70.37%), Postives = 23/27 (85.19%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DH +GYWMP++QHG V H Sbjct: 82 EHPGWVKVDHEKGYWMPIEQHGKPVCH 108
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Match: A0A835XUH0_9CHLO (Uncharacterized protein n=1 Tax=Edaphochlamys debaryana TaxID=47281 RepID=A0A835XUH0_9CHLO) HSP 1 Score: 53.9 bits (128), Expect = 4.740e-8 Identity = 18/27 (66.67%), Postives = 23/27 (85.19%), Query Frame = 0 Query: 29 EHPGWVKIDHPEGYWMPVQQHGHDVMH 55 EHPGWVK+DHP+ YW+P++QHG V H Sbjct: 58 EHPGWVKVDHPKDYWLPIEQHGKPVCH 84 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20153.6062.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 10
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig20153.6062.1 ID=prot_L-elsbetiae_contig20153.6062.1|Name=mRNA_L-elsbetiae_contig20153.6062.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=59bpback to top |