mRNA_L-elsbetiae_contig2011.6048.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2011.6048.1 vs. uniprot
Match: A0A6H5KEN5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEN5_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 2.580e-6 Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 1 Query: 1 TPLHEAASRGHVEIVRALLAAGARRNPRASMVKCLFLSSLHQPHVFPHEARGVTPLHLAAQQGQAAVIRILVEAGANVNIL 243 TPLHEA++RG VE+ +ALL AGAR++ AS F + +T L LA + G V+R LVEAGA+VN++ Sbjct: 94 TPLHEASARGGVEVTKALLQAGARKDIFAS---------------FGRDGPFLTALDLAVENGHLEVVRTLVEAGADVNLI 159
BLAST of mRNA_L-elsbetiae_contig2011.6048.1 vs. uniprot
Match: A0A6H5KST3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KST3_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 2.830e-6 Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 1 Query: 1 TPLHEAASRGHVEIVRALLAAGARRNPRASMVKCLFLSSLHQPHVFPHEARGVTPLHLAAQQGQAAVIRILVEAGANVNIL 243 TPLHEA++RG VE+ +ALL AGAR++ AS F + +T L LA + G V+R LVEAGA+VN++ Sbjct: 94 TPLHEASARGGVEVTKALLQAGARKDIFAS---------------FGRDGPFLTALDLAVENGHLEVVRTLVEAGADVNLI 159
BLAST of mRNA_L-elsbetiae_contig2011.6048.1 vs. uniprot
Match: A0A150FZ61_GONPE (Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150FZ61_GONPE) HSP 1 Score: 55.8 bits (133), Expect = 3.420e-6 Identity = 33/78 (42.31%), Postives = 45/78 (57.69%), Query Frame = 1 Query: 1 TPLHEAASRGHVEIVRALLAAGARRNPRASMVKCLFLSSLHQPHVFPHEARGVTPLHLAAQQGQAAVIRILVEAGANV 234 TPLH A +GH E+V+ LLAAGA + A ++ L QPH G T LHLAA++G V+ L+ AGA++ Sbjct: 69 TPLHAACWKGHTEVVKVLLAAGASPDAEAVLLPELAPPVRGQPHWL--RTGGFTLLHLAAKEGHVGVVEALIRAGASL 144
BLAST of mRNA_L-elsbetiae_contig2011.6048.1 vs. uniprot
Match: A0A3M2TGT1_9EURO (Ankyrin repeat-containing protein n=1 Tax=Aspergillus sp. HF37 TaxID=1960876 RepID=A0A3M2TGT1_9EURO) HSP 1 Score: 52.8 bits (125), Expect = 7.370e-5 Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 1 Query: 4 PLHEAASRGHVEIVRALLAAGARRNPRASMVKCLFLSSLHQPHVFPHEARGVTPLHLAAQQGQAAVIRILVEAGANVNILGGI 252 PLHEAA +G+VEIV+ L+ GA N +++ G+T L AA+ G+ AV+ L++AGAN NI GGI Sbjct: 351 PLHEAAGKGYVEIVKLLIEHGADLNSKSN---------------------GLTALMAAAENGRGAVVEELLQAGANPNIRGGI 412 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2011.6048.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig2011.6048.1 >prot_L-elsbetiae_contig2011.6048.1 ID=prot_L-elsbetiae_contig2011.6048.1|Name=mRNA_L-elsbetiae_contig2011.6048.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=182bp TPLHEAASRGHVEIVRALLAAGARRNPRASMVKCLFLSSLHQPHVFPHEAback to top mRNA from alignment at L-elsbetiae_contig2011:4412..5596- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig2011.6048.1 ID=mRNA_L-elsbetiae_contig2011.6048.1|Name=mRNA_L-elsbetiae_contig2011.6048.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1185bp|location=Sequence derived from alignment at L-elsbetiae_contig2011:4412..5596- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig2011:4412..5596- >mRNA_L-elsbetiae_contig2011.6048.1 ID=mRNA_L-elsbetiae_contig2011.6048.1|Name=mRNA_L-elsbetiae_contig2011.6048.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1092bp|location=Sequence derived from alignment at L-elsbetiae_contig2011:4412..5596- (Laminarionema elsbetiae ELsaHSoW15)back to top |