mRNA_L-elsbetiae_contig19715.5887.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A6H5L0Q2_9PHAE (VASt domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0Q2_9PHAE) HSP 1 Score: 85.9 bits (211), Expect = 2.060e-18 Identity = 39/44 (88.64%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 1 RDLADFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 + + DFSCAVESRILLHGRMYVT TFVCFYSNLFGFEKIIKIPF Sbjct: 71 KPVEDFSCAVESRILLHGRMYVTNTFVCFYSNLFGFEKIIKIPF 114
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: D7FKF6_ECTSI (VASt domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKF6_ECTSI) HSP 1 Score: 85.9 bits (211), Expect = 2.060e-18 Identity = 39/44 (88.64%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 1 RDLADFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 + + DFSCAVESRILLHGRMYVT TFVCFYSNLFGFEKIIKIPF Sbjct: 32 KPVEDFSCAVESRILLHGRMYVTNTFVCFYSNLFGFEKIIKIPF 75
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A482S830_9ARCH (GRAM domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482S830_9ARCH) HSP 1 Score: 73.9 bits (180), Expect = 2.200e-16 Identity = 31/42 (73.81%), Postives = 37/42 (88.10%), Query Frame = 1 Query: 7 LADFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 L DFSCAVES +LLHGRMY++T F+CFYSNLFG EK I+IP+ Sbjct: 4 LLDFSCAVESTVLLHGRMYISTRFICFYSNLFGLEKKIRIPY 45
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: F0Y4G3_AURAN (GRAM domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y4G3_AURAN) HSP 1 Score: 73.9 bits (180), Expect = 3.240e-16 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 DFSCA+E +ILLHGR+YVT F+CFYSNLFGFEK IKIP+ Sbjct: 2 DFSCAIERKILLHGRLYVTERFICFYSNLFGFEKKIKIPY 41
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A7S2STC3_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2STC3_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 9.320e-15 Identity = 33/40 (82.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 DFSCAVE +ILLHGRMYVT F+CFYSNLFGFEK IKIP+ Sbjct: 44 DFSCAVERKILLHGRMYVTDKFICFYSNLFGFEKKIKIPY 83
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A836CDE2_9STRA (GRAM domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CDE2_9STRA) HSP 1 Score: 68.9 bits (167), Expect = 2.590e-14 Identity = 28/40 (70.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 DFSCAV+SR+L+HGR+Y+T + FYSN+FGFEKII+IPF Sbjct: 2 DFSCAVQSRVLMHGRLYITPGHLLFYSNIFGFEKIIRIPF 41
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A8J2ST97_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2ST97_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 3.210e-14 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 DFSCA+E +ILLHGR+YVT F+CFYSNLFGFEK IKIP+ Sbjct: 63 DFSCAIERKILLHGRLYVTERFICFYSNLFGFEKKIKIPY 102
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A7S3NLX8_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NLX8_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 3.260e-14 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 DFSCA+E +ILLHGR+YVT F+CFYSNLFGFEK IKIP+ Sbjct: 167 DFSCAIERKILLHGRLYVTERFICFYSNLFGFEKKIKIPY 206
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: W7TDU9_9STRA (Gram domain-containing protein 1a n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TDU9_9STRA) HSP 1 Score: 72.4 bits (176), Expect = 1.090e-13 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 13 DFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 D SCAVES+ILLHGR+Y+T FVCFYSN FGFEK IKIPF Sbjct: 119 DASCAVESKILLHGRIYITDKFVCFYSNFFGFEKKIKIPF 158
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Match: A0A7S1U683_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1U683_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 1.740e-13 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 7 LADFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPF 132 L+DFSC+VES++ LHG MYVTT F+CFYSN FG+EK I +P+ Sbjct: 41 LSDFSCSVESKMTLHGHMYVTTRFICFYSNFFGYEKKILLPY 82 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19715.5887.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19715.5887.1 >prot_L-elsbetiae_contig19715.5887.1 ID=prot_L-elsbetiae_contig19715.5887.1|Name=mRNA_L-elsbetiae_contig19715.5887.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=46bp RDLADFSCAVESRILLHGRMYVTTTFVCFYSNLFGFEKIIKIPFW*back to top mRNA from alignment at L-elsbetiae_contig19715:531..668- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19715.5887.1 ID=mRNA_L-elsbetiae_contig19715.5887.1|Name=mRNA_L-elsbetiae_contig19715.5887.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=138bp|location=Sequence derived from alignment at L-elsbetiae_contig19715:531..668- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19715:531..668- >mRNA_L-elsbetiae_contig19715.5887.1 ID=mRNA_L-elsbetiae_contig19715.5887.1|Name=mRNA_L-elsbetiae_contig19715.5887.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=276bp|location=Sequence derived from alignment at L-elsbetiae_contig19715:531..668- (Laminarionema elsbetiae ELsaHSoW15)back to top |