Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19310.5720.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR006553 | Leucine-rich repeat, cysteine-containing subtype | SMART | SM00367 | LRR_CC_2 | coord: 6..31 e-value: 0.0029 score: 26.8 coord: 32..57 e-value: 1.0E-4 score: 31.7 coord: 58..83 e-value: 0.044 score: 22.9 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 1..93 e-value: 8.5E-25 score: 89.0 |
IPR001611 | Leucine-rich repeat | PFAM | PF13516 | LRR_6 | coord: 6..25 e-value: 0.08 score: 13.0 coord: 33..55 e-value: 0.021 score: 14.9 |
None | No IPR available | PANTHER | PTHR13382:SF4 | | coord: 45..92 coord: 4..54 |
None | No IPR available | PANTHER | PTHR13382 | MITOCHONDRIAL ATP SYNTHASE COUPLING FACTOR B | coord: 45..92 coord: 4..54 |
None | No IPR available | SUPERFAMILY | 52047 | RNI-like | coord: 5..93 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19310.5720.1 ID=prot_L-elsbetiae_contig19310.5720.1|Name=mRNA_L-elsbetiae_contig19310.5720.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=93bp ALGECCPGLQRLDVKGCDGVTDVGLAWMSSGCPALEYLDVSGCVKVSNAG VTSLCEKCPLLAHLGMASLKHVTDTGVARLGSGCTRLTHLDMS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|