prot_L-elsbetiae_contig192.5674.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig192.5674.1 vs. uniprot
Match: D7FUE4_ECTSI (Aminotran_1_2 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FUE4_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 2.220e-6 Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = 0 Query: 1 RSAKPGRWRPGPQRTQYKEYARSALASG 28 R+A PGRWRPGPQRTQYKEYARSALA+G Sbjct: 121 RNAIPGRWRPGPQRTQYKEYARSALAAG 148
BLAST of mRNA_L-elsbetiae_contig192.5674.1 vs. uniprot
Match: A0A836C7I6_9STRA (Pyridoxal phosphate-dependent transferase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C7I6_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 7.600e-6 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 0 Query: 1 RSAKPGRWRPGPQRTQYKEYARSALASGDPVT 32 R A+PG+WRPGPQRTQYKEYARSA A+G T Sbjct: 103 RQAEPGKWRPGPQRTQYKEYARSAQAAGFSTT 134 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig192.5674.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig192.5674.1 ID=prot_L-elsbetiae_contig192.5674.1|Name=mRNA_L-elsbetiae_contig192.5674.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=119bpback to top |