prot_L-elsbetiae_contig191.5624.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig191.5624.1 vs. uniprot
Match: Q8QNC6_ESV1K (EsV-1-156 n=1 Tax=Ectocarpus siliculosus virus 1 (isolate New Zealand/Kaikoura/1988) TaxID=654926 RepID=Q8QNC6_ESV1K) HSP 1 Score: 84.3 bits (207), Expect = 2.040e-17 Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 0 Query: 16 RKVKGEAVAQKNFHSKGLAPKILGYCNFKPKKRLRKSAHERLNDLEYDDD----DIEYHPRGHLVHIIVMEEIADVIGDWL 92 ++++GE AQ+ FH +GLAPKI+ YC+FKPK RL AHERLN D + P G+LVH+I+MEEIA V+G WL Sbjct: 103 KRLRGELSAQRAFHKRGLAPKIIRYCSFKPKTRLGMVAHERLNRAVQDKSVPFQTEDESPAGNLVHVIIMEEIAGVLGQWL 183 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig191.5624.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig191.5624.1 ID=prot_L-elsbetiae_contig191.5624.1|Name=mRNA_L-elsbetiae_contig191.5624.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |