prot_L-elsbetiae_contig1821.5260.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1821.5260.1 vs. uniprot
Match: D7FK70_ECTSI (tRNA-splicing endonuclease positive effector n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK70_ECTSI) HSP 1 Score: 97.8 bits (242), Expect = 3.430e-22 Identity = 51/67 (76.12%), Postives = 56/67 (83.58%), Query Frame = 0 Query: 2 EVAMQGGSFASAALGMSYCNRRETEAVVFAMELRLGEADVQAEDVTIITPYSAQVRLFQDLVSSSRR 68 E A+QGGSFASAALG SYCN RE EAV FA+EL L E DV+AEDV IITPYSAQVRL QD+V +SRR Sbjct: 607 EAAVQGGSFASAALGTSYCNVREAEAVAFALELLLREGDVEAEDVGIITPYSAQVRLLQDVVGTSRR 673
BLAST of mRNA_L-elsbetiae_contig1821.5260.1 vs. uniprot
Match: A0A6H5L473_9PHAE (AAA_11 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L473_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.200e-8 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = 0 Query: 2 EVAMQGGSFASAALGMSYCNRRETEAVVFAMELRLGEADVQ 42 E A+QGGSFASAALG SYCN RE EAV FA+EL L E DV+ Sbjct: 587 EAAVQGGSFASAALGTSYCNLREAEAVAFALELLLREGDVE 627 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1821.5260.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1821.5260.1 ID=prot_L-elsbetiae_contig1821.5260.1|Name=mRNA_L-elsbetiae_contig1821.5260.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=68bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|