prot_L-elsbetiae_contig17973.5139.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17973.5139.1 vs. uniprot
Match: D7G2V3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2V3_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 2.850e-18 Identity = 48/80 (60.00%), Postives = 52/80 (65.00%), Query Frame = 0 Query: 16 GSCFCHFLPNAVMGAYLTTLCPKVAMLSCLKKGLCESRPDRTWRFTREIGMPWVSTSISLPADAQQRITRQLSSAADTTS 95 G F F G P+ ++CLKK LCES PD TWR TREIGMP STSI LPADAQQ ITRQ+SSAADTTS Sbjct: 57 GKLFLPFFAERGDGGISHNSVPEGRYVNCLKKRLCESIPDSTWRLTREIGMP-KSTSILLPADAQQTITRQVSSAADTTS 135 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17973.5139.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17973.5139.1 ID=prot_L-elsbetiae_contig17973.5139.1|Name=mRNA_L-elsbetiae_contig17973.5139.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |