mRNA_L-elsbetiae_contig1788.5101.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1788.5101.1 vs. uniprot
Match: D8LLP9_ECTSI (Zinc binding dehydrogenase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLP9_ECTSI) HSP 1 Score: 55.5 bits (132), Expect = 2.270e-6 Identity = 34/70 (48.57%), Postives = 38/70 (54.29%), Query Frame = 1 Query: 70 LARRSLSWFSTSPSIQARRWLSACRVFADGSIRVENDDDRPGATTSPPGPGQVAVTLRSAPCTPADLRTL 279 L RR L T P RRWL FA+G D T+PPGPGQVAV L +APCTPADLR + Sbjct: 7 LLRRILHLRLTQP----RRWLGTRVRFAEGGGCSVEHGDGDDDCTAPPGPGQVAVKLLAAPCTPADLRAV 72 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1788.5101.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1788.5101.1 >prot_L-elsbetiae_contig1788.5101.1 ID=prot_L-elsbetiae_contig1788.5101.1|Name=mRNA_L-elsbetiae_contig1788.5101.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=79bp MAQSGWRTTTIDPVQLPPLQARAKSPLRCARPRARRRTCAHSAAPSAPRHback to top mRNA from alignment at L-elsbetiae_contig1788:10517..11339- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1788.5101.1 ID=mRNA_L-elsbetiae_contig1788.5101.1|Name=mRNA_L-elsbetiae_contig1788.5101.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=823bp|location=Sequence derived from alignment at L-elsbetiae_contig1788:10517..11339- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1788:10517..11339- >mRNA_L-elsbetiae_contig1788.5101.1 ID=mRNA_L-elsbetiae_contig1788.5101.1|Name=mRNA_L-elsbetiae_contig1788.5101.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=474bp|location=Sequence derived from alignment at L-elsbetiae_contig1788:10517..11339- (Laminarionema elsbetiae ELsaHSoW15)back to top |