prot_L-elsbetiae_contig8721.17750.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8721.17750.1 vs. uniprot
Match: D7FZY4_ECTSI (DNA repair enzyme n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZY4_ECTSI) HSP 1 Score: 81.3 bits (199), Expect = 9.840e-16 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 0 Query: 39 RAVSTVSAQGATANVTNEEALQRSVDTASRMAGWAGRVVERVLKEHRQP 87 RA S VSAQGATA+ TNE ALQRSVD ASRMAGWAGRVVERVLKEHR+P Sbjct: 821 RASSQVSAQGATASYTNEAALQRSVDMASRMAGWAGRVVERVLKEHRKP 869
BLAST of mRNA_L-elsbetiae_contig8721.17750.1 vs. uniprot
Match: A0A6H5KXJ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXJ8_9PHAE) HSP 1 Score: 80.1 bits (196), Expect = 2.500e-15 Identity = 63/102 (61.76%), Postives = 69/102 (67.65%), Query Frame = 0 Query: 1 GAVKEEGSDEDFDGFVDDDXXXXXXXXXXXXEDELARGRAVSTVSAQGATANVTNEEALQRSVDTASRMAGWAGRVVERVLKEHRQPAL-PSSSSSVAAAAG 101 GAV+E+ SD FDGFV XXXXXX RA S VSAQGAT + TNE ALQRSVD ASRMAGWAGRVVERVLKEHR+ PS S A+A+G Sbjct: 788 GAVEED-SDXXFDGFV---------XXXXXXXXXXXXXRASSQVSAQGATTSYTNEAALQRSVDMASRMAGWAGRVVERVLKEHRKARKRPSFSHRAASASG 879 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8721.17750.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8721.17750.1 ID=prot_L-elsbetiae_contig8721.17750.1|Name=mRNA_L-elsbetiae_contig8721.17750.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bpback to top |