prot_L-elsbetiae_contig8692.17721.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8692.17721.1 vs. uniprot
Match: D7G7N7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7N7_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 2.510e-11 Identity = 33/45 (73.33%), Postives = 41/45 (91.11%), Query Frame = 0 Query: 110 SAEIADEDLRGVASAVVKRLGTGRPLKPDTFDEFSEAVDRLLKST 154 SA I+DEDL+ VASA+VKRLGTG+PL+P FDEFS+AVDR+L+ST Sbjct: 460 SAGISDEDLKTVASALVKRLGTGKPLQPAAFDEFSDAVDRVLEST 504
BLAST of mRNA_L-elsbetiae_contig8692.17721.1 vs. uniprot
Match: A0A6H5L2Q2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2Q2_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 9.070e-11 Identity = 32/44 (72.73%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 111 AEIADEDLRGVASAVVKRLGTGRPLKPDTFDEFSEAVDRLLKST 154 A I+DEDL+ VASA+VKRLGTG+PL+P FDEFS+AVDR+L+ST Sbjct: 606 AGISDEDLKTVASALVKRLGTGKPLQPAAFDEFSDAVDRVLEST 649 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8692.17721.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8692.17721.1 ID=prot_L-elsbetiae_contig8692.17721.1|Name=mRNA_L-elsbetiae_contig8692.17721.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=160bpback to top |