prot_L-elsbetiae_contig86.17635.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig86.17635.1 vs. uniprot
Match: D7FT26_ECTSI (EsV-1-7 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FT26_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 2.300e-10 Identity = 44/79 (55.70%), Postives = 53/79 (67.09%), Query Frame = 0 Query: 163 RNIKRFDALSSRQPSPASSLRSSPAEGEDAAAAEEGDQADGKL-STKRCGFEGCRKRPTYGVEGSRVAKFCSPHAEQGM 240 RN+KR D+ R + + SL S PA G+ GDQ GKL STKRC F CRKRPTYGVEGS+ A+FC+PHA+ GM Sbjct: 5 RNVKRHDSFGLRMQASSLSLPS-PASGDVG-----GDQPGGKLPSTKRCSFPQCRKRPTYGVEGSKTAEFCAPHAQPGM 77 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig86.17635.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig86.17635.1 ID=prot_L-elsbetiae_contig86.17635.1|Name=mRNA_L-elsbetiae_contig86.17635.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=796bpback to top |