prot_L-elsbetiae_contig857.17607.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig857.17607.1 vs. uniprot
Match: D7FT14_ECTSI (Putative AAA family ATP ase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT14_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 1.650e-11 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 19 RFVRRLYVPLLNKSGRRQLVNILLKTSPSSLTADDVEEAVEG 60 RFV+RLYVPL +KSGRRQL+NILLKTS SSLTA+DVE VEG Sbjct: 396 RFVKRLYVPLPDKSGRRQLMNILLKTSVSSLTAEDVETVVEG 437
BLAST of mRNA_L-elsbetiae_contig857.17607.1 vs. uniprot
Match: A0A6H5JMF7_9PHAE (AAA domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMF7_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 4.240e-11 Identity = 33/42 (78.57%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 19 RFVRRLYVPLLNKSGRRQLVNILLKTSPSSLTADDVEEAVEG 60 RFV+RLYVPL +K+GRRQL+NILLKTS SSLTA+DVE VEG Sbjct: 666 RFVKRLYVPLPDKTGRRQLMNILLKTSVSSLTAEDVETVVEG 707 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig857.17607.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig857.17607.1 ID=prot_L-elsbetiae_contig857.17607.1|Name=mRNA_L-elsbetiae_contig857.17607.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bpback to top |