prot_L-elsbetiae_contig8377.17378.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8377.17378.1 vs. uniprot
Match: D8LU53_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LU53_ECTSI) HSP 1 Score: 106 bits (265), Expect = 3.440e-22 Identity = 54/69 (78.26%), Postives = 64/69 (92.75%), Query Frame = 0 Query: 237 EIIRDIFAEEVWFDMTTIRSRFFDCPTEEIKMKALTIMAMEARAAPAMKRKKMNNMRAAAK---RKPSF 302 EIIRDIFAEEVWFDMT IRSRFFDCP+E+++MKALTI+AMEAR+AP+MKRKK+NN+RAA K RKPS+ Sbjct: 432 EIIRDIFAEEVWFDMTAIRSRFFDCPSEDLRMKALTIIAMEARSAPSMKRKKINNIRAATKAKKRKPSY 500
BLAST of mRNA_L-elsbetiae_contig8377.17378.1 vs. uniprot
Match: A0A6H5KS00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS00_9PHAE) HSP 1 Score: 105 bits (261), Expect = 1.810e-21 Identity = 53/68 (77.94%), Postives = 63/68 (92.65%), Query Frame = 0 Query: 238 IIRDIFAEEVWFDMTTIRSRFFDCPTEEIKMKALTIMAMEARAAPAMKRKKMNNMRAAAK---RKPSF 302 I+RDIFAEEVWFDMT IRSRFFDCP+E++KMKALTI+AMEAR+AP+MKRKK+NN+RAA K RKPS+ Sbjct: 851 ILRDIFAEEVWFDMTAIRSRFFDCPSEDLKMKALTIIAMEARSAPSMKRKKINNIRAATKAKKRKPSY 918 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8377.17378.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8377.17378.1 ID=prot_L-elsbetiae_contig8377.17378.1|Name=mRNA_L-elsbetiae_contig8377.17378.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=302bpback to top |