prot_L-elsbetiae_contig8312.17318.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8312.17318.1 vs. uniprot
Match: A0A6H5JGG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGG2_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 2.030e-7 Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = 0 Query: 4 RKEKCAHHLGCTKQPSFGVAGTKNPEFCSEHKKDGMMNVTSRRCNH 49 R+ C GCT +PS+G AG K EFCS+HKK GMMN+ S+RC H Sbjct: 22 RQRLCCQEDGCTTRPSYGNAGCKKAEFCSQHKKPGMMNLVSKRCGH 67
BLAST of mRNA_L-elsbetiae_contig8312.17318.1 vs. uniprot
Match: A0A6H5KY67_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY67_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 1.250e-6 Identity = 22/43 (51.16%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 7 KCAHHLGCTKQPSFGVAGTKNPEFCSEHKKDGMMNVTSRRCNH 49 +C GCT +PS+G+ G K EFCS+H K GM+N+T +RC H Sbjct: 25 RCCQEHGCTVRPSYGIDGCKKAEFCSKHSKPGMINLTKKRCGH 67
BLAST of mRNA_L-elsbetiae_contig8312.17318.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 3.500e-6 Identity = 24/44 (54.55%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 4 RKEKCAHHLGCTKQPSFGVAGTKNPEFCSEHKKDGMMNVTSRRC 47 R +C H CTK+P++GVAG+K EFCS+H +DGM+NV ++RC Sbjct: 60 RMSQCGHE-NCTKRPTYGVAGSKKREFCSQHARDGMVNVNNKRC 102
BLAST of mRNA_L-elsbetiae_contig8312.17318.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 4.170e-6 Identity = 22/37 (59.46%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 11 HLGCTKQPSFGVAGTKNPEFCSEHKKDGMMNVTSRRC 47 H CTK+P++GVAG+K EFCS+H +DGM+NV ++RC Sbjct: 6 HANCTKRPTYGVAGSKKREFCSQHARDGMVNVNNKRC 42 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8312.17318.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8312.17318.1 ID=prot_L-elsbetiae_contig8312.17318.1|Name=mRNA_L-elsbetiae_contig8312.17318.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=800bpback to top |