prot_L-elsbetiae_contig8305.17308.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8305.17308.1 vs. uniprot
Match: A0A6H5K212_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K212_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 3.110e-18 Identity = 47/91 (51.65%), Postives = 57/91 (62.64%), Query Frame = 0 Query: 8 GKEPLMRSASSPPSISCFRGSAGDSGGRQPERPGRQNITPPRRHPLGLIGGLVEESHHPTVPSPVAHREEDAAAPAAEGCPGLCSSVGSDN 98 GKEPL RSASSPPSI+C RG + RP RQN+TPP+RHP+GLI G++EES HP PSP ++ D+ G GL S G N Sbjct: 158 GKEPLKRSASSPPSINCARGPPNEDDATCSSRPDRQNVTPPQRHPVGLIDGIIEESRHPLAPSPAKDKDGDSVG---AGLLGLYHSAGRRN 245 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8305.17308.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8305.17308.1 ID=prot_L-elsbetiae_contig8305.17308.1|Name=mRNA_L-elsbetiae_contig8305.17308.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=125bpback to top |