prot_L-elsbetiae_contig8038.17026.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8038.17026.1 vs. uniprot
Match: D7G3E1_ECTSI (Similar to camp and camp-inhibited cgmp 3,5-cyclic phosphodiesterase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3E1_ECTSI) HSP 1 Score: 106 bits (265), Expect = 4.100e-25 Identity = 48/54 (88.89%), Postives = 51/54 (94.44%), Query Frame = 0 Query: 29 MFLRGCKEPLEQYRECLMKNLKDWNGRGLHRGKLAEVKIHQLGQMNITRFDHQK 82 MFLRGC+EPLEQYRECLMKNLKDW+GRGL R KL+ VKIHQLGQMNITRFDHQK Sbjct: 1 MFLRGCREPLEQYRECLMKNLKDWHGRGLVRQKLSAVKIHQLGQMNITRFDHQK 54
BLAST of mRNA_L-elsbetiae_contig8038.17026.1 vs. uniprot
Match: A0A6H5JUX4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUX4_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 1.870e-17 Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 0 Query: 16 MVMEAGTDLVDPGMFLRGCKEPLEQYRECLMKNLKDWNGR 55 M +AGTDLVD GMFLRGC+EP+EQYRECLMKNLKDW+GR Sbjct: 1 MKKDAGTDLVDAGMFLRGCREPMEQYRECLMKNLKDWHGR 40
BLAST of mRNA_L-elsbetiae_contig8038.17026.1 vs. uniprot
Match: A0A835ZCA7_9STRA (SAM domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZCA7_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 2.940e-11 Identity = 35/60 (58.33%), Postives = 41/60 (68.33%), Query Frame = 0 Query: 23 DLVDPGMFLRGCKEPLEQYRECLMKNLKDWNGRGLHRGKLAEVKIHQLGQMNITRFDHQK 82 DL+D FL+ LEQYREC M NL +GRGL R KLA+V++H L MNITR DHQK Sbjct: 4 DLIDVRTFLK--PTGLEQYRECFMTNLWGGDGRGLSRRKLAQVQMHHLPDMNITRHDHQK 61 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8038.17026.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8038.17026.1 ID=prot_L-elsbetiae_contig8038.17026.1|Name=mRNA_L-elsbetiae_contig8038.17026.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=82bpback to top |